(data stored in ACNUC7421 zone)

EMBL: CP000820.PE188

CP000820.PE188       Location/Qualifiers
FT   CDS_pept        complement(233346..235850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0190"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase central domain
FT                   protein; Clp domain protein; ATPase associated with various
FT                   cellular activities AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: fal:FRAAL6680 ATP-dependent
FT                   protease, HSP 100, part of multi-chaperone system with
FT                   DnaK, DnaJ, and GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09657"
FT                   /db_xref="GOA:A8LCL8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL8"
FT                   /protein_id="ABW09657.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKGDPATAGAPAEGTPS
FT                   TSLVLDQFGRNLTAAARESKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAV
FT                   VEGLAQAIVKGEVPETLKDKQLYTLDLGALVAGSRYRGDFEERLKKVLKEIRTRGDIIL
FT                   FIDELHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKHLEKDAALERRFQ
FT                   PIQVAEPSVAHTIEILKGLRDRYEAHHRVSITDAALVAAASLADRYISDRFLPDKAIDL
FT                   IDEAGSRMRIRRMTAPPDLREFDERIANVRRDKESAIDAQDFEKAASLRDKEKTLLAEK
FT                   AKREKEWKAGDMDVVAEVGDEEIAEVLAIWTGIPVFKLTEEETARLLRMEDELHRRVIG
FT                   QEQAIKAVSQAIRRTRAGLKDPKRPGGSFIFAGPSGVGKTELSKTLAEFLFGDEDSLIQ
FT                   LDMSEYMEKHTVSRLVGSPPGYVGYEEGGQLTERVRRKPFSVVLFDEVEKAHPDVFNTL
FT                   LQILEDGRLTDSQGRLVDFKNTVLIMTSNLGTRDISKGPGIGFATGQGAVDYERMKAKV
FT                   QDELKQHFRPEFLNRIDDIIVFHQLSENEIIQIVDLMLARVDSQLKNKDMALELTPAAK
FT                   ALLAKRGYDPVLGARPLRRTIQREIEDILSEKILYGTLRPGEIVVGDVEGEGEEAKFVF
FT                   RGEPKPNSVPDSPPIDLAKSSE"
     atgttcgaga ggttcaccga ccgggcacgt cgggtcgtcg tcctggccca agaagaggcc        60
     aggatgctca accacaacta catcgggacc gagcacatcc tgctcggcct gatccacgag       120
     ggcgagggcg tcgccgctaa ggccctcgag tcgctcggga tctcgctcga gggtgtgcgg       180
     tcacaggtcg aggagatcat cgggcagggt cagcaggcgc cgagcgggca catcccgttc       240
     acgccccggg ccaagaaggt cctcgagctg tccctgcgtg aggctctcca gctcggccac       300
     aactacatcg gcaccgagca cattctgctc ggcctgatcc gcgagggcga gggcgtcgcc       360
     gcccaggtgc tggtcaagct cggcgcggac ctcaaccggg tccgtcagca ggtcatccag       420
     ctcctgtccg gctaccaggg caagggtgac ccggcgaccg ccggcgcccc ggccgaggga       480
     acgccgtcga cctcgctggt cctcgaccag ttcggccgca acctcaccgc ggccgctcgt       540
     gagtccaagc tcgacccggt catcgggcgc gagaaggaga tcgagcgcgt catgcaggtg       600
     ctgtcgcgcc ggacgaagaa caaccccgtc ctgatcggcg agcccggcgt cggcaagacc       660
     gccgtcgtcg aggggctcgc gcaggcgatc gtcaagggcg aggtccccga gaccctgaag       720
     gacaagcagc tctacaccct cgacctcggc gcgctcgtcg ccgggtcccg ctaccgcggt       780
     gacttcgagg agcggctgaa gaaggtcctc aaggagatcc gcacccgcgg cgacatcatc       840
     ctgttcatcg acgagctcca cacgctcgtc ggtgcgggtg ccgccgaggg cgcgatcgac       900
     gccgcctcca tcctcaagcc catgctggcg cgcggggagc tgcagacgat cggcgcgacc       960
     acgctggacg agtaccgcaa gcacctggag aaggacgccg ctctcgagcg gcggttccag      1020
     ccgatccagg tcgcggagcc gtcggtggcg cacaccatcg agatcctcaa gggcctgcgc      1080
     gaccggtacg aggcgcacca ccgcgtctcg atcaccgacg ccgccctggt ggccgcggcc      1140
     tccctggccg accgctacat ctccgaccgg ttcctgccgg acaaggccat cgatctgatc      1200
     gacgaggccg gctcccggat gcgcatccgc cggatgaccg ctccgccgga cctgcgggag      1260
     ttcgacgagc gcatcgcgaa cgtccgccgg gacaaggagt ccgcgatcga cgcgcaggac      1320
     ttcgagaagg ccgcgtcgct gcgcgacaag gagaagaccc tgctggccga gaaggccaag      1380
     cgggagaagg agtggaaggc cggcgacatg gacgtcgtcg ccgaggtcgg cgacgaggag      1440
     atcgcggagg tcctcgcgat ctggaccggc atcccggtct tcaagctcac cgaggaggag      1500
     accgcgcgtc tgctccgcat ggaggacgag ctccaccgcc gggtcatcgg ccaggagcag      1560
     gccatcaagg ccgtctccca ggcgatccgg cgcacccgcg ccgggctgaa ggacccgaag      1620
     cgccccggcg gctcgttcat cttcgccggc ccgtccggtg tcggtaagac ggagctgtcg      1680
     aagacgctgg cggagttcct cttcggcgac gaggactcgc tcatccagct cgacatgtcc      1740
     gagtacatgg agaagcacac cgtctcgcgg ctggtgggct ccccgcccgg ctacgtcggg      1800
     tacgaggagg gcggccagct caccgagcgg gtgcggcgca agccgttctc cgtggtcctc      1860
     ttcgacgagg tcgagaaggc ccacccggac gtcttcaaca cgctcctgca gatcctggag      1920
     gacggtcgcc tgaccgactc ccagggccgg ctggtcgact tcaagaacac cgttctgatc      1980
     atgacgtcga acctgggcac ccgggacatc tccaagggcc ccggcatcgg gttcgccacc      2040
     ggccagggcg cggtcgacta cgagcggatg aaggcgaagg tccaggacga gctcaagcag      2100
     cacttccggc ctgagttcct caaccggatc gacgacatca tcgtcttcca ccagctctcc      2160
     gagaacgaga tcatccagat cgtggatctc atgctcgccc gggtcgacag ccagctgaag      2220
     aacaaggaca tggcgctgga gctcacgccg gccgccaagg ccctgctcgc caagcgtggc      2280
     tacgacccgg tgctcggcgc ccggccactg cgccggacga tccagcggga gatcgaggac      2340
     atcctgtccg agaagatcct gtacgggacg ctgcgtcccg gcgagatcgt ggtcggcgac      2400
     gtcgagggtg agggcgagga ggcgaagttc gtcttccgcg gcgagccgaa gccgaactcg      2460
     gtgccggact ccccgccgat cgacctcgcc aagtccagcg agtga                      2505
//

If you have problems or comments...

PBIL Back to PBIL home page