(data stored in ACNUC7421 zone)

EMBL: CP000820.PE189

CP000820.PE189       Location/Qualifiers
FT   CDS_pept        complement(236419..237513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09658"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL9"
FT                   /protein_id="ABW09658.1"
FT                   /translation="MPGPPAQRDGGGAIDCRTTQMIPAQNCATRPVGLAGFGSTLRAVA
FT                   PALDHRHAIAGSPEPADGWIDATDLRSPAGLDAALGVIRDHHQASAEVAVSYLTAWYAA
FT                   TIVGPAVTAFVLTRRVPDLDPAGISVHCREGGWFDATAFRTRRMTIMYSDPVLTAPVPA
FT                   RIASELIAQAGGPVTEQVLPAGTYDRYPDSVGPPDSASYPDSVGYPEGITADDPIEVVE
FT                   AVADVETLRARLVSQIVGHLEPVLADLRPRARLGHAALWGAVAAQCGRAFLLTERVSGD
FT                   PHAGRLEADAFFASASPPLRARPTWQQFVHHGRPYTGMRRGSCCLAHRVTAEFCTACPF
FT                   VAAEERENRLREWIDTQGPGGLAV"
     gtgcccggcc cgcccgccca gcgtgacggt ggcggcgcga tcgactgccg gaccacgcag        60
     atgattccgg cccagaactg cgcgacccgg cccgtcggcc tggcgggttt cggctccacc       120
     ctgcgagcgg tggccccggc cctcgaccac cgccacgcga tcgccgggtc gcccgagccg       180
     gccgacggct ggatcgacgc caccgacctg cgcagccccg cggggctgga cgcggcgctc       240
     ggcgtcatcc gcgatcatca ccaggccagc gccgaggttg ccgtcagcta cctcaccgcc       300
     tggtatgcgg cgaccatcgt cgggccggcc gtcaccgcgt tcgtcctcac ccgccgggtc       360
     cccgacctcg acccggccgg gatctcggtg cactgtcgcg aaggcggctg gttcgacgcc       420
     accgcgttcc gaacgcggcg gatgacgatc atgtactcgg atcccgtcct gacggcgccg       480
     gtgccagcgc ggattgcatc agaactgatc gcccaggccg gcggccccgt caccgaacag       540
     gtgctcccgg ccggcaccta cgaccgctac ccggacagcg tcggcccccc ggacagcgcc       600
     agttacccgg atagcgtcgg ctaccccgag ggcatcacag cggacgaccc gatcgaggtc       660
     gtggaggccg tggccgacgt cgagacgctg cgcgcgcggc tggtgagcca gatcgtcggc       720
     cacctcgagc ccgtgcttgc cgacctgcgc ccgcgggccc gtctcggcca cgcggcgctg       780
     tggggcgccg tcgccgcgca gtgcggccgt gcctttcttc tcaccgaacg ggtgagtggt       840
     gatccacacg ccggccgcct ggaggcggac gccttcttcg cgagcgcgtc accgccgctg       900
     cgggcgagac cgacctggca gcagttcgtc catcacggcc ggccgtacac gggcatgcgg       960
     cgcggctcgt gctgcctggc gcaccgggtc accgccgagt tctgcacggc gtgtccgttc      1020
     gtggccgccg aggagcgcga gaaccggctc cgggagtgga tcgacaccca gggtcccggc      1080
     ggtctggcgg tgtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page