(data stored in ACNUC7421 zone)

EMBL: CP000820.PE190

CP000820.PE190       Location/Qualifiers
FT   CDS_pept        complement(237759..238037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09659"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM0"
FT                   /protein_id="ABW09659.1"
FT                   /translation="MLISWTRPRVGSVSGQARHRSVGSQVRSVTGRRVAQSRRSATANP
FT                   SAVGSVVLRAGQAKKIEGGTRRARPPSRRRSGRVHQGGRGWVADVSG"
     ttgctgatct cgtggacgcg gccccgggtc gggtcagtct cgggtcaggc gcgtcacagg        60
     tcagttgggt cacaggtcag atcggtcaca ggtcgccgag ttgcccagtc gcgtaggtcg       120
     gccacggcga atccgtccgc ggtcggttca gtggtcctgc gcgcggggca ggcgaagaag       180
     atagaaggtg gcacccggcg ggcccgtccg ccgagccgtc ggcggtcggg ccgggtccac       240
     cagggcggac gcggctgggt agcggacgtt tccgggtga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page