(data stored in ACNUC7421 zone)

EMBL: CP000820.PE192

CP000820.PE192       Location/Qualifiers
FT   CDS_pept        239718..240254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5505 conserved hypothetical protein;
FT                   putative flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09661"
FT                   /db_xref="GOA:A8LCM2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM2"
FT                   /protein_id="ABW09661.1"
FT                   /translation="MTTSPRVLYHVVCAALPALAAADFATEARRDGWDVCVVTTPRAAA
FT                   WLDLPALAAATGHPVRTDYKFPGQPDVLPPPAAFVVVPATFNTINKWAAGIADTLVLGL
FT                   LTEALGLGLPVVAAPCLAEPQAAHPAFAASCRTLRGAGVRLLDRWTARDPGLAAGGWET
FT                   ADTHRVLAELRSAAG"
     atgacgacct caccgcgagt gctctaccac gtcgtgtgcg cggcgctgcc cgcgctggcc        60
     gccgcggact tcgccaccga ggcccgccgg gacggctggg acgtgtgcgt cgtgacgacg       120
     ccgcgggccg ccgcctggct ggacctgcct gccctcgccg cggccacggg acatcccgtg       180
     cgcaccgact acaagtttcc gggccagccc gacgtcctcc cgccgccggc cgccttcgtg       240
     gtggtcccgg cgaccttcaa cacgatcaac aagtgggcgg ccggcatcgc ggacaccctc       300
     gtgctggggc tgctcaccga ggcgctcggc ctcggtctcc cggtcgtcgc ggcgccctgc       360
     ctggcggagc cgcaggcggc ccatccggcc ttcgcggcgt cgtgccgcac gctgcgcggc       420
     gccggcgtgc ggctgctcga ccgctggacg gcgcgcgatc ccggcctggc cgccggcggc       480
     tgggagacgg ccgacaccca ccgggtgctc gccgagctcc ggtccgccgc gggctga          537
//

If you have problems or comments...

PBIL Back to PBIL home page