(data stored in ACNUC7421 zone)

EMBL: CP000820.PE193

CP000820.PE193       Location/Qualifiers
FT   CDS_pept        complement(240264..241235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6675 putative secreted lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09662"
FT                   /db_xref="GOA:A8LCM3"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM3"
FT                   /protein_id="ABW09662.1"
FT                   /translation="MRHSTGATSRFGGPRGRRGRHGRHGRTALFNRTATFNRTAPFTWT
FT                   VLFVSAALFVLLGTPMGTAGAATAAPGTLTVAALGDSYSSGEGTPPFEAAFASCRRSAG
FT                   AWPRLLATLDPPATNVLHAACGGATTEAMTKPQRGSPPQLEQLRALPTPPDVVTLTIGG
FT                   NDAGFSQVMFSCVAWKCFWDGDDRRRRDYVEDVLPDVLVATYKEVKAAAPHSRIVVVGY
FT                   PTVVPRSQSDNTCRWLDKSERRQLASLNNALNRTIRRAASDAGVEYVSTDRSLRGHEMC
FT                   TKDSWVNPIGLFGASRSLSAHPTRAGQEALAKTVHRALFDDR"
     atgcggcaca gcacgggggc gacctcacga ttcggcggcc cgcgcggccg gcgcggccgg        60
     cacggccggc acggccggac ggcactgttc aaccgaacag cgacgttcaa ccgaacagcg       120
     ccgttcacct ggacggtact gttcgtctcg gccgcactgt tcgttctcct cgggacaccg       180
     atggggacgg ccggggcggc gaccgcggcc ccgggaacgc tgaccgtggc cgcgctgggc       240
     gactcgtact cctccggtga gggaacgccc ccgttcgaag cggccttcgc gagctgccgc       300
     cgcagcgccg gggcgtggcc acggctgctc gccaccctcg acccgccggc caccaacgtc       360
     ctgcacgcgg cgtgcggggg cgcgacgaca gaggcgatga ccaagcctca gcggggctcc       420
     ccgccccagc tcgaacagct gcgcgccctg ccgaccccac cggacgtggt gacgctgacc       480
     atcggcggca acgacgccgg gttcagccag gtcatgttca gctgtgtcgc atggaagtgc       540
     ttctgggacg gcgacgaccg ccgccggcgg gactacgtcg aggacgtgct tcccgacgtc       600
     ctggtcgcca cctacaaaga ggtgaaggcc gcggcgccgc actcccggat cgtggtcgtc       660
     gggtatccca ccgtcgttcc gcggtcccag agcgacaaca cctgccgatg gctcgacaag       720
     agtgagcgcc gccagctcgc cagcctgaac aacgcgctca accggactat ccgcagagcg       780
     gcgtccgacg ccggtgtcga gtacgtatcg accgatcggt ccctgcgcgg gcatgaaatg       840
     tgcaccaagg actcctgggt gaatccgatc ggccttttcg gcgcgagccg gagtctcagc       900
     gcccatccga cccgggccgg ccaggaggcc ctggcgaaaa ccgtccacag ggccctcttc       960
     gacgaccgct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page