(data stored in ACNUC7421 zone)

EMBL: CP000820.PE194

CP000820.PE194       Location/Qualifiers
FT   CDS_pept        complement(241413..242174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0196"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family; PFAM: Bvg accessory factor; KEGG: fal:FRAAL6674
FT                   conserved hypothetical protein; putative transcriptional
FT                   activator (Baf family)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09663"
FT                   /db_xref="GOA:A8LCM4"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LCM4"
FT                   /protein_id="ABW09663.1"
FT                   /translation="MLLTIDVGNTNTVLGVFDGDQLANSWRVRTDPRATADELGWLYRG
FT                   LLGDHPIGGVSVCSTVPAALREIRRMVSRTFPAMPTVVVEPGTRTGVPILIDNPKEAGA
FT                   DRIMNTLAAHHLYGGPAIVVDFGTATNIDVVSARGEFLGGAFAPGIEVALDALASRAAQ
FT                   LRNVELTTPRSVIGKSTVEALQSGMIYGVVGQVDALVRRIRAELGTPATTIATGGLAPL
FT                   VIKESETLDNHEPHLTLIGLRLVFEKNTEPR"
     atgctgctga cgatcgacgt aggcaacacg aacaccgtgc tgggtgtttt cgacggcgat        60
     cagctcgcca actcgtggcg ggtccgcacc gacccgagag cgaccgccga cgagctgggc       120
     tggctctacc gcggcctcct cggcgaccac ccgatcggcg gtgtctcggt gtgttccacc       180
     gtgccggccg ccctccggga gatccgccgg atggtcagcc ggacgttccc ggcgatgccg       240
     accgtcgtcg tcgagcccgg cacccgcacc ggggtgccga tcctgatcga caacccgaag       300
     gaggccggcg ccgaccggat catgaacaca ctggccgccc accacctcta cggcggcccg       360
     gcgatcgtgg tcgacttcgg cacggccacg aacatcgacg tggtgtccgc gcggggcgag       420
     ttcctcggcg gggcgttcgc gccgggcatc gaggtcgcgc tggacgcgtt ggcctcccgt       480
     gccgcgcagc tgcgcaacgt cgagctgacc accccccgtt cggtgatcgg caagagcacc       540
     gtcgaggcac tgcagtccgg gatgatctac ggcgtcgtcg gccaggtgga cgcgctggtc       600
     cgccgcatcc gggccgagct gggcacaccg gccaccacga tcgccaccgg cggcctggcc       660
     ccgctggtga tcaaggagag cgagaccctc gacaatcacg agccgcacct gaccctgatc       720
     gggctgcggc ttgtcttcga gaagaacacc gaaccgcgct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page