(data stored in ACNUC7421 zone)

EMBL: CP000820.PE196

CP000820.PE196       Location/Qualifiers
FT   CDS_pept        complement(243259..245055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0198"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="KEGG: fal:FRAAL6672 L-aspartate oxidase (LASPO)
FT                   (quinolinate synthetase B); TIGRFAM: L-aspartate oxidase;
FT                   PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09665"
FT                   /db_xref="GOA:A8LCM6"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM6"
FT                   /protein_id="ABW09665.1"
FT                   /translation="MPVLPHRLGAPRPGWTRHADIVVIGSGVAGLTTVLHARAASPDSR
FT                   VLLVTKALLDAGSTRWAQGGIAAALGVGDSPAEHHRDTLVAGVGLCDPVAVDILVTEGP
FT                   ARVRELAALGARFDREPDGALSLTREGGHLRDRIAHAGGDATGLEVERALIAAVRADPS
FT                   IEVLEHALVLDLLTDRGGRAVGATLHVLGEGSRDGVGAVTARAIVLATGGMGQIFASTT
FT                   NPAVSTGDGVALALRAGAVVTDLEFVQFHPTALWLPEHESGQQPLVSEAMRGEGALLVD
FT                   AAGRRVMAGVHPLADLAPRDVVAKRMSRVMAEQGVRHLFLDARHLGTETLLRRFPTITA
FT                   RCRAAGIDPVTMPIPVAPAAHYASGGVRTDVWGRTSVPGLYACGEVACTGVHGANRLAS
FT                   NSLLEGLVFAARIAEHIAGLPGVRPVDGPGGTPSTGEPTGARGSGLTDPTERGDLARVM
FT                   TDGAGVLRSAESLRATSKMLAGLGDLRVSGATVQAGPAAWEMTNLRTVATALVAAAELR
FT                   TETRGCHWREDFGARDDEHWRGHVLTRLDQEGKLIVTYEAPPAEERSNGARAAQGPSAR
FT                   SQAPSAPSAPSGRSAASQARSA"
     gtgcctgttc ttccgcaccg actcggcgcg ccccgtccgg gctggaccag gcacgccgac        60
     atcgtggtca tcgggtccgg ggtcgccggg ctcaccaccg tgctgcacgc gcgcgcggcg       120
     agcccggaca gccgcgtcct gctggtcacc aaggccctgc tggacgccgg atcgacccgc       180
     tgggcccagg gcggcatcgc cgcggccctg ggcgtcgggg actccccggc cgagcaccac       240
     cgcgacaccc tcgtggccgg ggtcggcctg tgcgacccgg tggcggtcga catcctggtc       300
     accgagggtc ccgcccgggt gcgggagctc gcggcgctcg gcgcccggtt cgaccgggag       360
     cccgacgggg cgctctcact cacccgcgag ggcggccacc tgcgcgatcg catcgcgcac       420
     gccggtggcg acgccaccgg gctggaggtg gagcgcgcac tgatcgccgc cgtgcgcgcc       480
     gacccgtcca tcgaggtgct cgagcacgcg ctcgtcctcg acctgctcac ggaccgaggc       540
     gggcgggcgg tcggagccac gctgcacgtg ctcggcgagg gcagccggga cggcgtcggc       600
     gccgtgacgg cacgcgcgat cgtcctggcc accggtggca tggggcagat cttcgcgtcg       660
     acgaccaatc cggcggtctc caccggcgac ggtgtggcgc tcgccctgcg tgccggggcg       720
     gtcgtgaccg acctggagtt cgtccagttc catccgacgg cactgtggct gcctgagcac       780
     gagtcgggcc agcagccgct ggtcagcgag gctatgcgcg gcgagggcgc gctgctggtg       840
     gacgcggccg gccggcgggt gatggccggc gtccacccgc tggccgacct ggcgccccgg       900
     gacgtcgtcg cgaagcggat gtcgcgggtg atggccgagc agggggtgcg ccacctgttc       960
     ctcgatgccc gccacctggg caccgagacg ctcctgcgcc ggttcccgac catcaccgcc      1020
     cggtgccggg ccgcgggcat cgacccggtg accatgccga tcccggtggc cccggcggcg      1080
     cactacgcca gtggcggggt ccgcactgac gtgtgggggc gcacgagcgt ccccgggctg      1140
     tacgcgtgcg gggaggtcgc ctgcacgggg gtgcacgggg cgaaccggct ggcgtccaac      1200
     agcctgctgg aggggctggt gttcgcggcg cgaatcgccg agcacatcgc cgggctgccc      1260
     ggggtccgcc cggtggacgg acccggcggc acgccgtcca ccggggagcc gacgggcgcg      1320
     cggggatcgg gcctgaccga tccgaccgag cgcggtgacc tggcccgggt gatgaccgac      1380
     ggggcgggcg tcctgcgcag cgccgagagc ctgcgggcga cgtccaagat gcttgccggc      1440
     ctcggtgacc tgcgggtcag cggggcgacc gtgcaggccg ggccggcggc ctgggagatg      1500
     acgaacctgc gcacggtggc gaccgcgctg gtcgcggcgg cggagctgcg caccgagacc      1560
     cgcggctgcc actggcgcga ggacttcggc gcccgcgacg acgagcactg gcgcgggcat      1620
     gtgctgacca ggctggatca ggaggggaag ctgatcgtga cctacgaggc accgccggcc      1680
     gaggaacggt cgaacggggc acgcgcggcg cagggcccgt cggcccggtc gcaggccccg      1740
     tcagccccgt cagctccgtc gggccggtcg gcggcgtccc aggcgcggtc ggcgtga         1797
//

If you have problems or comments...

PBIL Back to PBIL home page