(data stored in ACNUC7421 zone)

EMBL: CP000820.PE198

CP000820.PE198       Location/Qualifiers
FT   CDS_pept        complement(245513..246595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0200"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: fal:FRAAL6670 pantothenate synthetase;
FT                   TIGRFAM: pantoate--beta-alanine ligase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09667"
FT                   /db_xref="GOA:A8LCM8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM8"
FT                   /protein_id="ABW09667.1"
FT                   /translation="MPAQSPARPISGPAAPTSLPSPAAPTSPSASAGPGGGTTASGSPA
FT                   RTGRPAVARTRAELATLLSEPAASPVGDGPARGVRAVVMTMGALHRGHAELIRAARRRA
FT                   DQVVVTIFVNPLQFGPGEDLDRYPRTFEADLDLCAREGVDAVYAPTQVHDPAPLVTLSA
FT                   GRLGDVLEGASRPGHFDGMLTLVGTMLHLVRPDVAFFGRKDAQQLVCIRRMVADLAFQV
FT                   EIVGVPTVRDTDGLALSSRNAYLGPEQRRSALALSRALSAGTRQAGAGAAAVLSAAWSV
FT                   LAAEPGVDVDYLTLANPSDLGPVEVGPALLLVAARVGNTRLIDNVELVLTGAGPAPVDD
FT                   EARSKDHNEARNDAGKDKEV"
     atgcctgccc aatcgcccgc ccgcccgatt tccgggccgg ccgcaccgac ctcgctgccc        60
     tcgccggccg caccgacctc gccatcggcg tcagccgggc cggggggcgg gaccaccgcc       120
     tccggatcac cggcccgaac gggccggccc gccgtcgccc gcacccgcgc cgagctcgcc       180
     accctgctga gcgaacccgc cgcgtccccc gtcggggacg gccccgcgcg gggggtgcgc       240
     gccgtcgtga tgacgatggg cgccctgcac cgcgggcacg ccgagctgat cagagcggcc       300
     cggcgccggg ccgaccaggt ggtggtcaca atcttcgtaa acccgctgca gttcgggccg       360
     ggtgaggatc tcgaccgcta cccccgcacc ttcgaggcag acctcgatct ctgcgcgcgc       420
     gagggtgtcg acgccgtcta cgccccgacc caggtccatg atcccgcacc gctggtcacc       480
     ctgagtgccg gccggctcgg cgacgtcctc gagggggcgt cccggccagg ccacttcgac       540
     gggatgctca ccctggtcgg cacgatgctg cacctcgtgc gccctgatgt ggccttcttc       600
     ggccgcaagg acgcccagca gctcgtctgc atccgccgga tggtcgccga cctggcgttc       660
     caggtggaga tcgtcggagt gccgacggtg cgggacaccg acggtctcgc cctgtcgagc       720
     cgaaacgcct accttgggcc ggagcagcgg cgcagcgcgc tggcgctctc ccgggcactg       780
     tccgccggca ccaggcaggc tggagcgggc gcggcggccg tactgtccgc ggcctggtcg       840
     gtgctggccg ccgagccggg cgttgacgtc gactacctga cgctggccaa cccgtccgat       900
     ctcgggccgg tcgaggtcgg gccggcgctg ctgctggtcg ccgcccgggt cgggaacacc       960
     cggctgatcg acaacgtcga actcgtcctg acgggggccg ggccggcccc cgtcgacgac      1020
     gaagcccgca gcaaagacca caacgaggct cgcaacgacg ccggcaagga caaggaggtc      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page