(data stored in ACNUC7421 zone)

EMBL: CP000820.PE199

CP000820.PE199       Location/Qualifiers
FT   CDS_pept        complement(246842..249385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0201"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: fal:FRAAL6669
FT                   hypothetical protein; putative multidrug efflux transporter
FT                   AcrB transmembrane domains"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09668"
FT                   /db_xref="GOA:A8LCM9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM9"
FT                   /protein_id="ABW09668.1"
FT                   /translation="MRTRPPTASTPRRSPAPSGSGASDGPADRGPRHAHRAAPTSASPD
FT                   SPTHATHLAARAARWSVRHRRLAIGGWILGVVLVTLLGSLIGTSTLGDDDYSVGEDGRA
FT                   QSTLDAHGFTSPANENVLIQRPAQAASPEELLADPELRAALADVAARLDGTGEVTNLRA
FT                   PIALPGVEANPGLVSTDRRSVMVTFEMRGDEDTATDRIDPVLAAVAAAADEHPGLLVEE
FT                   VGEASADKALGDTIGKDFKRAELLAIPLTLGILLAVFGAVVAALVPVALALTAFVGALG
FT                   VVAFTSRLLPTDETATSVMLLIGLAVGVDYALFYIRREREERAAGHSPQRALEIAADTS
FT                   GHAVLVSGLTVAVSMAGLLLTGLSVFSGIAGGTVIVVLIAVLGSLTVLPAVLSWLGDRV
FT                   ELLRLPWHRRADARAAAAGAPGADRKTTSSTTSTTSVAGTAGVDLTRPGLMGRLLRRPG
FT                   IVAVVTGGLLILLAVPALGLRTVEPGMDDIPDDLPIMQTYDRVQAAFPGEQTAAVVVVS
FT                   AADVRAPQAVGAIDALRERALASGMMYEPITTEISADGQVAKISIPIAGGGTDDASLRV
FT                   LDTLRGEIIPSTIDPVSGMSADVTGWTAGSADFNAQLNGRTPLVIGFVLVLAFLLLLAA
FT                   FRSAIVAAAAVALNLLSVAAAYGLLVVVFQHHWADGLLGYTSTGAITNWLPLMLFVILF
FT                   GLSMDYQVFVLSRVREAYDSGLPMRDAVLVGVRRSAGVVTSAAVIMVAVFSIFATLSQV
FT                   SMKQLGVGLGAAILLDATVIRVILMPAVLTLIGERAWRRRPAADDDDRGTAVPVPAGDR
FT                   RPQLPAQAPAPAAPPAPAGHGPFSGMGDFPRHRQD"
     atgcgcacga gacctccgac agcatcgacg ccgcgccgct cacccgcccc gtcggggtcc        60
     ggcgcctcgg acgggccggc cgaccgcggc ccacgccatg ctcaccgggc cgcgccgacc       120
     agcgcgtccc ccgacagccc cacgcacgcc acccacctgg ccgcccgcgc ggcccggtgg       180
     agcgtgcggc accgccgcct cgccatcggc ggctggatcc tcggcgtcgt gctcgtcacg       240
     ctgctgggga gcctgatcgg gaccagcacc ctcggtgacg acgactacag cgtcggtgag       300
     gacgggcggg cccagagcac cctggacgcg cacgggttca cctcccccgc caacgagaac       360
     gtgctgatcc agcggccggc gcaggccgcc agccccgagg agctgctcgc cgaccccgag       420
     ctgcgggccg ccctcgcgga cgtcgccgcg cggctcgacg gcaccggtga ggtgaccaac       480
     ctgcgggcgc cgatcgcgct acccggggtg gaggcgaacc ccgggctggt gtccaccgac       540
     cgtcgttcgg tcatggtgac cttcgagatg cgcggtgacg aggacaccgc caccgaccgg       600
     atcgacccgg tgctggccgc cgtcgcggcc gcggccgacg agcatccggg gctgctcgtc       660
     gaggaggtcg gcgaggcgag tgccgacaag gcgctcggcg acacgatcgg caaggacttc       720
     aagcgggccg agctgctcgc catcccgctc accctcggca ttctgctggc cgtcttcggc       780
     gcggtcgtcg ccgcgctggt gccggtcgcg ctcgcgctga ccgcgttcgt cggggcgctg       840
     ggtgtcgtcg ccttcaccag ccggctgctg cccacggacg agaccgcgac ctcggtcatg       900
     ctgctcatcg gcctggcggt cggcgtcgac tacgccctgt tctacatccg ccgcgagcgc       960
     gaggagcgag ccgccgggca cagcccgcaa cgcgcgctgg agatcgccgc ggacacttcg      1020
     ggtcacgccg ttctggtgtc cgggctgacg gtcgccgtct cgatggcggg cctgctgctg      1080
     accgggctga gcgtgttcag cgggatcgcc ggcggcacgg tcatcgtggt gctgatcgcg      1140
     gtgctcggct cgctcacggt gctgccggcg gtgctgtcct ggctgggtga ccgggtcgag      1200
     ctcctgcggc tgccctggca ccgccgcgcc gacgcccgcg ccgccgccgc cggcgccccg      1260
     ggcgcggaca ggaagaccac gtcgagcacc acgagcacca cgagcgtcgc cggcaccgct      1320
     ggcgtcgatc tgacccggcc cggcctgatg ggacggctgc tgcgccgccc cggcatcgtc      1380
     gcggtggtca ccggcgggct gctgatcctg ctggcagtgc ccgccctggg gctgcggacc      1440
     gtcgaaccgg gcatggacga catccccgac gatcttccga tcatgcagac ctacgatcgg      1500
     gtccaggcgg ccttcccggg cgagcagacg gccgcggtcg tcgtggtctc ggccgccgac      1560
     gtgcgggcgc cgcaggcggt gggagccatc gacgcgctgc gcgagcgggc gctggccagc      1620
     ggaatgatgt acgaaccgat caccaccgag atcagcgcgg acggccaggt cgccaagatc      1680
     tcgatcccga tcgccggcgg gggcaccgac gacgcttcgc tgcgggtgct cgacacgctg      1740
     cgcggagaga tcatccccag cacgatcgac ccggtctccg ggatgtcggc ggacgtcacc      1800
     gggtggacgg ccggttcggc cgacttcaac gcccagctca acgggcgcac cccgctggtg      1860
     atcgggttcg tgctggtcct ggccttcctg ctgctgctgg ccgcgttccg cagcgccatc      1920
     gtcgccgcgg cggccgtcgc gctgaacctg ctgtcggtgg ccgcggcgta cggcctgctc      1980
     gtggtggtgt tccagcatca ctgggcggac ggcctgctcg gctacacctc gaccggggcc      2040
     atcaccaact ggctgccgct gatgctcttc gtgatcctgt tcggcctgtc catggactat      2100
     caggtgttcg tgctcagccg ggtccgggag gcctacgact cgggcctgcc gatgcgcgac      2160
     gcggtgctgg tcggggtccg gcgtagcgcg ggggtggtga ccagcgcggc cgtgatcatg      2220
     gtggcggtgt tcagcatctt cgccaccctg tcgcaggtga gcatgaagca gctcggcgtg      2280
     gggctcggcg cggcgatcct gctggacgcg accgtgatca gggtgatcct gatgcccgcc      2340
     gtcctgacgc tgatcggcga gcgggcgtgg cgccgccggc ccgccgccga cgacgacgac      2400
     cgggggacgg ccgtcccggt gccggcgggt gaccgccggc cgcagctccc ggcgcaggcc      2460
     cccgcgcccg ccgcgccccc cgcacccgcc ggccacggcc cgttctccgg catgggcgac      2520
     ttcccccgtc accgccagga ctga                                             2544
//

If you have problems or comments...

PBIL Back to PBIL home page