(data stored in ACNUC7421 zone)

EMBL: CP000820.PE20

CP000820.PE20        Location/Qualifiers
FT   CDS_pept        25853..26017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6838 putative transmembrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09489"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX46"
FT                   /protein_id="ABW09489.1"
FT                   /translation="MAGEGSRRRGVGMRKFTVVALVASAGALLTAARRRRNKDEIDLWR
FT                   EATSAAGNR"
     gtggctggcg aaggcagtcg acgaagggga gtcggtatgc gcaagttcac tgtcgtcgcc        60
     ctcgtggcga gcgccggcgc actcctcacc gccgcccgtc gccgcaggaa caaggacgag       120
     atcgacctgt ggcgcgaggc gacgtccgcg gcggggaacc gctga                       165
//

If you have problems or comments...

PBIL Back to PBIL home page