(data stored in ACNUC7421 zone)

EMBL: CP000820.PE205

CP000820.PE205       Location/Qualifiers
FT   CDS_pept        complement(253842..254405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0207"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: fal:FRAAL6664 phosphoribosylaminoimidazole
FT                   carboxylase = AIR carboxylase, catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09674"
FT                   /db_xref="GOA:A8LDQ9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDQ9"
FT                   /protein_id="ABW09674.1"
FT                   /translation="MSVSQGKSSQGNGARGGSMDPRVAIVYGSPSDTQTMSKAGATLER
FT                   FGVAYEEVSLSAHRAPRTLAEYVGKLRAREIQVVIAGAGLAAALPGAVAALTTLPVIGV
FT                   PISGGALDGMDSMLAIAQMPPGVPVATVGLNNSTNAAILAIQILALGDPDLGLKLATFK
FT                   DEFEQAAADSLADVAAAATAAARA"
     gtgagcgtgt cgcagggcaa gtcgtcacag ggcaacgggg caaggggcgg ctcgatggat        60
     ccgcgggtgg cgatcgtcta cggctccccg tcggacaccc agaccatgag caaggccggc       120
     gccaccctgg agcgcttcgg ggtcgcctac gaggaggtct ccctctcggc gcaccgcgcc       180
     ccgcgcacgc tcgcggagta cgtcgggaag ctgcgcgcgc gggagatcca ggtggtgatc       240
     gccggcgccg ggctcgccgc cgcgctgccg ggcgccgtcg cggccctgac gaccctgccg       300
     gtcatcggcg tgccgatctc cggtggcgcg ctggacggca tggactccat gctcgccatc       360
     gcgcagatgc cgcccggcgt gccggtggcc accgtcgggc tgaacaactc gacgaacgcc       420
     gcgatcctcg cgatccagat cctggcgctg ggcgacccgg atctcggcct gaagctcgcg       480
     acattcaagg acgagttcga gcaggcagcg gccgactctc tcgctgacgt cgcggcggcg       540
     gcgaccgcgg cggcacgcgc atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page