(data stored in ACNUC7421 zone)

EMBL: CP000820.PE207

CP000820.PE207       Location/Qualifiers
FT   CDS_pept        complement(255770..256045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09676"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR1"
FT                   /protein_id="ABW09676.1"
FT                   /translation="MHSFSRRASSKRIKGRRQRRRAPPKPRGPSRAPGGGPDHATRRWS
FT                   VEAARVLPWSLLADEQADIAGTSRSPGHSGRHRRQGHKAKDDQRAR"
     atgcactcat tcagtcgccg cgcttcatcg aaacggataa aaggacgtcg acagcgccga        60
     cgcgcgcccc cgaagccccg cggcccgagc cgggcgccgg gcgggggccc ggaccatgcg       120
     acacggcggt ggtcggtgga ggcggcacgg gtcctgccgt ggtctcttct tgctgatgag       180
     caagcggaca ttgctggcac cagtcgatcc ccgggacact cgggacggca tcgccgacag       240
     ggccacaagg caaaggatga tcaacgtgcg cgctaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page