(data stored in ACNUC7421 zone)

EMBL: CP000820.PE208

CP000820.PE208       Location/Qualifiers
FT   CDS_pept        complement(256145..257083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09677"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR2"
FT                   /protein_id="ABW09677.1"
FT                   /translation="MAGYPSQASWDDEHADGADGAGSEITNETLATARPSTELEPATAP
FT                   RQPGPARWSPTVHPDHPLRRGIDPATWPVGFSPTGEALPEALTDVLLRGSHAIRSSKRA
FT                   EAQRLERAAAIAEHVQAQIDDFLGFCAAERLTPPVIVRTNGRRAERSHDDVPDWNGTPR
FT                   LRTSTTGRAAARAGEDGSRQDRRRGEDDADPDTASPPPTGRHGRRSGTTPARRRLLRRE
FT                   RLHAWPLLYWRCESFPAPGRSLHLFVEPDGRTFEGRDAPAPLTVLGREVQVWPVDAPSI
FT                   VEGMAEVDARRCALHLVHGMAHMLWQAGVGL"
     atggcgggat acccgtcgca ggcctcctgg gacgacgagc acgccgacgg cgccgacggc        60
     gcaggctccg agatcacgaa cgagacactc gccaccgcgc gaccctcgac cgaactcgag       120
     ccggcgacgg caccacgcca gccaggcccg gcacgctggt cacccaccgt ccatcctgac       180
     catccgctgc gccgcggcat cgaccccgcg acgtggccgg tcggtttctc ccccaccggc       240
     gaggcgctgc cggaggccct gaccgacgtt ctcctgcgcg gcagtcacgc catccgcagc       300
     tcgaagcgcg ccgaggccca gcgcctcgag cgggcggcgg cgatcgccga gcacgtccag       360
     gcccagatcg acgacttcct gggcttctgc gcggccgagc gcctcacccc accggtcatc       420
     gtccgcacga acggccgccg cgccgaacga tcccacgacg atgtccccga ctggaacggc       480
     acgccacgac tccggacgtc aaccacgggc cgcgccgccg cacgggccgg ggaggacggc       540
     tccagacagg accgccgccg tggcgaggac gacgcggacc ccgacaccgc cagtccgcca       600
     cccaccggcc ggcacggacg tcggtcgggg accacaccgg cacgccgccg gctccttcgc       660
     cgcgagcggc tgcacgcctg gccactcctc tactggcgct gcgagagttt cccggccccg       720
     ggacgctccc tgcacctgtt cgtcgaaccg gacggacgca ccttcgaggg ccgcgacgcc       780
     cccgcgccgc tgacggtgct cggccgtgag gtgcaggtgt ggcccgtcga cgccccgtcg       840
     atagtcgagg gcatggccga ggtggacgcc cgccgttgcg cacttcacct ggtgcacgga       900
     atggctcaca tgctctggca ggccggcgtg ggcctgtag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page