(data stored in ACNUC7421 zone)

EMBL: CP000820.PE21

CP000820.PE21        Location/Qualifiers
FT   CDS_pept        complement(26159..26716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0021"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fal:FRAAL6835 polyamine
FT                   ABC-transporter integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09490"
FT                   /db_xref="GOA:A8KX47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX47"
FT                   /protein_id="ABW09490.1"
FT                   /translation="MSSTVLGMMIGISLGKHRFRGRAGVEFLLFSSISAPEVVLGASLL
FT                   SLFITLGVPRGYLTILIAHAMFNISYVAVVVRARLAGFDTSVEEAARDLGAGPWTTFRL
FT                   VTLPMIAPGVLSAALLAFALSIDEYVITTFNAGSTLTFPLWVFGATRAGVPPQVNVLAT
FT                   IIFISGVTLALLNAVVLRRRRT"
     atgtcgtcga ccgtgctggg aatgatgatc gggatctcgc tgggaaagca ccgcttccgc        60
     ggccgggccg gtgtggagtt cctgctgttc tccagcatct ccgcgcccga ggtggtgctc       120
     ggcgcatccc tgctctccct gttcatcacc ctcggggtgc cgcggggcta tctgaccatc       180
     ctcatcgcgc acgcgatgtt caacatctcc tacgtggcgg tggtcgtgcg cgcgcggctc       240
     gccggattcg acacgtccgt cgaggaggcc gcccgcgacc tcggcgcggg cccgtggacg       300
     accttccgcc tggtcaccct gccgatgatc gcgccgggcg tgctgagcgc cgcgctgctg       360
     gcgttcgcgc tgtcgatcga cgagtatgtg atcacgacat tcaacgcggg aagcacgctc       420
     accttcccgc tgtgggtgtt cggcgcgacc cgggcgggtg tgccgcccca ggtgaacgtt       480
     ctggccacca tcatcttcat cagtggcgta acgctcgcgc tactcaacgc ggtggtgctg       540
     cgccgccgcc ggacctga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page