(data stored in ACNUC7421 zone)

EMBL: CP000820.PE210

CP000820.PE210       Location/Qualifiers
FT   CDS_pept        complement(258685..259113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09679"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR4"
FT                   /protein_id="ABW09679.1"
FT                   /translation="MTTPPANQNLLSGPPPTLLPSDAAAADALRAGDTPDTVAARFPAI
FT                   SLGWAVLAEDALRAGRPVEAYAYARTGYHRGLDQLRRSGWKGHGPVPWSHEPNRGFLRA
FT                   LAALSRAAAEINDSEEAARCRQFLTDSDPAAAAELGLA"
     atgacgacac cgcccgcgaa ccagaacctc ctgtcgggcc cgccgcccac gctgctgccc        60
     tccgacgcgg cggccgcgga cgcactgcgg gccggcgaca cgccggacac ggtcgccgcc       120
     cggttcccgg ccatcagcct cggctgggcg gtcctcgccg aggacgcgct gcgcgccggg       180
     cgcccggtgg aggcgtacgc ctacgcacgg accgggtacc accggggcct ggaccagctc       240
     cgccggtccg gctggaaggg gcacgggccg gtcccgtggt cccacgagcc gaaccgcggc       300
     ttcctgcgcg cgctggccgc actctcccgc gccgcggcgg agatcaacga tagcgaggag       360
     gcggcccggt gccggcagtt cctcacggac agcgacccgg ccgcggccgc ggaactcggt       420
     ctcgcatag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page