(data stored in ACNUC7421 zone)

EMBL: CP000820.PE214

CP000820.PE214       Location/Qualifiers
FT   CDS_pept        complement(263232..263471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09683"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR8"
FT                   /protein_id="ABW09683.1"
FT                   /translation="MRFSHITACGPASARRYEFSSCLMTAWPAAGSLLAYSARLSTARP
FT                   MATIFHQCDLSVRTTLHDAVAKLMSAHARAIPAP"
     ttgcgtttct cacacatcac ggcatgcggg ccagcatcag cacgacgata tgaattttct        60
     agctgcttga tgacggcctg gccggccgcg ggtagccttc tcgcatattc ggctcgattg       120
     tcgacagcac gcccaatggc aacgatcttt caccagtgtg atctgtcggt acgaaccacc       180
     ctccacgacg cggtcgccaa gttaatgagc gcgcatgcgc gcgcgatacc agcaccgtga       240
//

If you have problems or comments...

PBIL Back to PBIL home page