(data stored in ACNUC7421 zone)

EMBL: CP000820.PE217

CP000820.PE217       Location/Qualifiers
FT   CDS_pept        266560..268047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0219"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG: fal:FRAAL6653
FT                   conserved hypothetical protein; putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09686"
FT                   /db_xref="GOA:A8LDS1"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS1"
FT                   /protein_id="ABW09686.1"
FT                   /translation="MHSERPERGRAAPSGPGLRVRPGSNARPSAHARPALRARSSRAAD
FT                   PPGPAGPVQDVVRGRRHRRRPTPRRAGGLRAAAGLVALTLVTLGLVAASGEVPSTSSAA
FT                   GRGLSGSNRVVADGSVAGGTGAGTADHTAGTDAVGAPPGSASRSGRGALAGYGGSSADP
FT                   VWPADRGPVSGVLVLRADPALLAIMAADGQPGSAPGEPWVLYLLSGPVNVIRWAMGEPF
FT                   EASIDTRQLPNGDYTLSEVIFRATHAPLVRTGRVPVANPLPPGADQTAPGGAAPRSAAA
FT                   AAADPGDGTAPGTPAGPAGSASAGVSGSPTGAGLPSGAEPAAGASTAAGASTAAGAVAG
FT                   PAPAPVASGARLAGTPTGAGGGAGSAATAALIEEVVTRTNAQRSAAGCPALTVDARLAA
FT                   SAQEHSADMAARNYFDHNGRDGRSPFDRIAAAGYVFSIAAENIAAGQRTPADVVADWMA
FT                   SPGHRANILNCSLSQIGVGLATGGDYGTYWVQDFGSP"
     atgcactcag agcgtcctga acgtggccgg gctgcaccgt ccggtccggg cttgcgtgta        60
     cggccgggct cgaatgcacg accgagcgcg catgcgcggc cggccctgcg tgcgcggagt       120
     tcgcgcgccg cggacccgcc cggccccgcg ggcccggtcc aggacgtggt ccgtggccgg       180
     cggcaccgaa gacgtcccac gcccaggcgg gcgggcgggc tgcgcgccgc cgcggggctg       240
     gtggcgctga cgctggtcac gctcgggctc gtggcggcct cgggcgaggt cccctcgacg       300
     tcgagcgcgg cgggccgtgg cctctccggg tccaacaggg ttgtcgcgga cgggtccgtc       360
     gcgggcggga ccggtgcggg caccgcggat cacaccgcgg gcacggatgc cgtcggcgca       420
     ccgcctggca gtgcgtcgcg gagcgggcgg ggcgccctgg cggggtacgg cgggtcgtcc       480
     gccgatccgg tgtggccggc cgaccggggg ccggtgagcg gtgtgctggt tctgcgggcc       540
     gatcccgcgc tgctcgcgat catggccgcc gacgggcaac cgggctcggc accgggcgag       600
     ccctgggtcc tctacctgct ctcgggcccc gtgaacgtga tccggtgggc gatgggcgag       660
     ccgttcgagg caagcatcga cacccggcag ctgccgaacg gcgactacac cctgtccgag       720
     gtgatcttcc gtgcgacgca cgccccgctg gtccgcaccg gccgggtgcc cgtcgcgaac       780
     cccctcccgc ccggggcgga ccagacggct ccgggcggag ccgcgccgcg gtcagcggcg       840
     gccgccgccg ccgatccggg cgacggcacg gccccgggta cgccggccgg ccctgccggg       900
     tcggcctccg cgggagtgtc cggctccccg acgggcgccg gtttgccgtc gggcgccgag       960
     ccggcggcgg gcgcgagcac cgcggcgggc gcgagcaccg cggcgggcgc ggtggccggg      1020
     ccggcaccgg cccccgtcgc ttccggcgcc cggctcgccg ggaccccgac cggcgcgggc      1080
     ggcggtgccg ggtcggcggc gacggccgcg ctgatcgagg aggtcgtcac gcggaccaat      1140
     gcccagcgct cggccgcggg ctgcccggcc ctcacggtcg acgcccgcct ggcggcttcg      1200
     gcccaggagc acagcgcgga catggcggcc cggaactact tcgaccacaa cggccgggac      1260
     gggcggtcgc ccttcgaccg gatcgcggcg gcgggctacg tcttctcgat cgcggcggag      1320
     aacatcgcgg ccggccagcg gaccccggcc gacgtcgtcg cggactggat ggcgagcccc      1380
     ggccaccggg cgaacatcct gaactgttcg ctcagccaga tcggtgtcgg gctcgccacc      1440
     ggaggtgact acggcaccta ctgggtccag gatttcggct cgccgtaa                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page