(data stored in ACNUC7421 zone)

EMBL: CP000820.PE218

CP000820.PE218       Location/Qualifiers
FT   CDS_pept        268359..269465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0220"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: fal:FRAAL6652 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09687"
FT                   /db_xref="GOA:A8LDS2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS2"
FT                   /protein_id="ABW09687.1"
FT                   /translation="MVRSVVTGAAGFLGGAVAHELRRRGDEVIGLDVRRAPGVTLADVT
FT                   MSGSWEKALEGADLLVHAAAVGMGGVGELAPVRAGRATPPSGITTAQMRKVLLGGTATV
FT                   LDAAQRAGVRRVVHLSCVSALGDDAPHAADESAPVGLTGEPRADAIAAAEQTVSAAAAH
FT                   GAPVTVLRIADAYGPRAGRWTLWPVLLMRAGRFVLVDGGRGMLSPVHVDDVVSAVMAVA
FT                   AAPGETVTGQVLHVTGPGPATVAEFFGRYAAMAQVRAPRSVPARLCEVVDAVDRLPSRQ
FT                   PASAGGRPGLLRGIGAALMANVDPRVRVDLGPLTIQDVTRRGTVSGDRIAALVGWRGEV
FT                   DLDEGMRRTGSWLRDRGLLGVPEPARRG"
     gtggtgcggt cggtggtcac cggcgcggcc ggattcctcg gcggcgccgt ggcgcatgag        60
     ctccgtcggc gcggtgacga ggtcatcggg ctcgacgtgc ggcgtgcgcc gggcgtcacc       120
     ctggccgacg tcacgatgtc cgggagctgg gagaaggcgc tcgagggcgc tgacctgctc       180
     gtgcacgccg ccgccgtggg catgggcggc gtcggggagc tggcgccggt gcgggccggc       240
     cgggcgaccc cgcccagcgg gatcaccacc gcgcagatgc gcaaggtgct gctcggcggg       300
     accgcgacgg tgctcgacgc ggcccagcgc gctggtgtcc gccgcgtggt ccacctgtcc       360
     tgcgtgagcg cgctcggcga cgacgcaccg cacgcggccg acgagtccgc gccggtcggc       420
     ctcaccggcg agccgcgcgc cgacgcgatc gccgccgccg agcagaccgt cagcgcggcc       480
     gccgcccacg gggcccccgt caccgtgctg cggatcgccg acgcctacgg cccgcgcgcc       540
     ggccgctgga cgctgtggcc cgtgctgctg atgcgggccg gccggttcgt cctcgtcgac       600
     ggcgggcgcg gcatgctgag ccccgtccac gtcgacgacg tggtgagcgc ggtgatggcc       660
     gtcgcggccg ccccgggcga gacggtgacc ggccaggtgc tgcacgtgac cggtccgggc       720
     ccggcgacgg tggccgagtt cttcgggcgg tacgccgcga tggcgcaggt gcgggcgccc       780
     cggtccgtgc ctgcgcggct gtgcgaggtc gtcgacgccg tcgaccggct gccgagccgg       840
     cagccggcgt ccgcgggcgg ccgtccgggc ctgctgcgcg ggatcggcgc ggccctcatg       900
     gccaacgtgg acccgcgtgt ccgggtcgac ctcggcccgc tgacgatcca ggacgtcacc       960
     aggcgcggca cggtctccgg ggaccggatc gccgcgctcg tcggctggcg gggcgaggtc      1020
     gacctcgacg agggcatgcg gcggacgggt tcctggctgc gcgaccgggg cctgctgggg      1080
     gtcccggagc cggcccgccg tgggtga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page