(data stored in ACNUC7421 zone)

EMBL: CP000820.PE22

CP000820.PE22        Location/Qualifiers
FT   CDS_pept        complement(26953..28206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0022"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: fal:FRAAL6833 ABC-transporter polyamine-binding
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09491"
FT                   /db_xref="GOA:A8KX48"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX48"
FT                   /protein_id="ABW09491.1"
FT                   /translation="MTSNDRQGIPAAPGASHGAVPDPALLRGLTRRRFDRRDLLRLTRA
FT                   AGSAALLAACGVKGEAGDSAQAADVAGYWAGKAKAGTLDFANWPLYMDVGSTDAERPSL
FT                   DLFTQETGIKVTYREVIQENESFFAQIRPSLAENQPIGYDLMVLTNGITLSRVIQLGYL
FT                   APLDHKRLPTFAANADPSVKDPAYDPGNQFTVAWQSGITGIAYDPEKTGREITSFADLM
FT                   DPAFAGKVGMFGENQELPNLALLGIGVAPADSAPEDWRRAADKLIEQRDAGIVRKYYDQ
FT                   SYIDSLAGGDLWISMAWSGDVYQQLAAGTKLKFVVPEEGGLIWTDSMCIPRTAAHPVDA
FT                   LTYMDFVYRPDIAGMLAEYINYITPVPAARDHVSPELAESTLLFPTRAEFDRVHRFRVL
FT                   TTEEETEWNKIFQPVYQS"
     gtgaccagca atgaccggca gggaattccc gcggcaccgg gggcgtcgca cggggcggtt        60
     cccgacccgg cgctgctgcg cggcctgacc agacgtcgtt tcgaccgacg ggacctcctg       120
     cgcctcacca gggcggccgg tagcgccgcg ctcctggccg cctgtggggt caagggcgag       180
     gccggtgatt cggcgcaggc cgccgacgtc gccggctact gggcgggcaa ggcgaaggcg       240
     ggaacgctcg acttcgcgaa ctggccgctc tacatggatg tcggtagcac cgacgcggag       300
     cgtccctcgc tcgacctgtt cacccaggag acgggcatca aggtcaccta ccgcgaggtg       360
     atccaggaga acgagtcctt cttcgcccag atccggccca gcctcgccga gaaccagcct       420
     atcgggtacg acctgatggt tctgaccaac ggcatcaccc tcagccgggt catccagctc       480
     ggttacctcg ccccgctcga ccacaagagg ctgcccacct tcgccgccaa cgccgacccg       540
     agcgtcaagg atcccgcgta cgacccggga aaccagttca ccgtggcctg gcagtccggt       600
     atcaccggca tcgcctacga cccggagaag accggccggg agatcaccag tttcgccgac       660
     ctcatggacc ccgccttcgc cggcaaggtc gggatgttcg gtgagaacca ggagctgccg       720
     aacctggcgc tactcggcat cggcgtcgcc ccggccgact ccgctccgga ggactggcgg       780
     cgcgcggccg acaaactgat cgagcagcgc gacgccggaa tcgtccgcaa gtactacgac       840
     cagagctaca tcgactcact cgccggcggc gacctgtgga tctcgatggc gtggtcgggg       900
     gacgtctacc agcagctcgc ggccgggacg aagctgaagt tcgtggtgcc ggaggaaggc       960
     ggcctgatct ggaccgacag catgtgcatc ccgaggaccg ccgcgcaccc ggtggacgcc      1020
     ctcacctaca tggacttcgt gtaccggccc gacatcgccg ggatgctggc cgagtacatc      1080
     aactacataa cgccggtgcc ggccgcccgt gaccacgtct cccccgagct ggccgaatcc      1140
     acgctgctgt tcccgacccg cgcggagttc gaccgtgtgc accgcttccg ggtgctgacg      1200
     acggaggagg agaccgagtg gaacaagatc ttccagccgg tctaccagtc ctag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page