(data stored in ACNUC7421 zone)

EMBL: CP000820.PE220

CP000820.PE220       Location/Qualifiers
FT   CDS_pept        270648..271739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09689"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS4"
FT                   /protein_id="ABW09689.1"
FT                   /translation="MSVDARREVPTGTRSSEVTYDHLIIPPHWRRPAGPGPGEPNPLFP
FT                   AGEQATAPPPGPAVTGASPINPMTGPMTGPLLVGTTARAFAKLDDMVRLGDDDRAVIDD
FT                   RRAEAERALRSIFPPRCALPLVGVATIGSAGRDTMIRPLDEVDIFVVFSAANSAWKRFR
FT                   WDSRDLLVCVRNAIGGDRVQTIGTRGQALRIVYDAAPDVHLVPAFDHPRAGYVIPDRVG
FT                   GWLPTRPERHASWTMDLGPRVISAVRLLKAWNRVCGSHLRSFHIEALAGQVLAGRGLNT
FT                   RQGLAEVFRHMDEVGLVVGDPSDIRGDLSSYLRQDDLEDLGAFVRQARTYSAKAVAAER
FT                   AGDHEEAVSLWGTVFGPEFPTFG"
     atgagcgtgg atgcccgtcg ggaagttcct accggaacac ggtcgagcga ggtcacgtac        60
     gaccatctga tcattccgcc gcactggcgg cggccggcgg ggcccgggcc gggggagccg       120
     aacccgctgt tccccgcggg cgagcaggcg acggcaccgc cgcccggccc cgccgtgacc       180
     ggcgcgtctc cgatcaatcc gatgaccggc ccgatgaccg gtccgctgct ggtcggcacg       240
     actgcccgcg ccttcgccaa gctggacgac atggtccggc tcggtgacga cgaccgcgcg       300
     gtgatcgacg accgacgggc ggaggcggag cgggcgctgc ggtcgatctt cccgccgcgc       360
     tgcgcgctgc ccctggtggg cgtggccacg atcgggtccg ccgggcgcga cacgatgatc       420
     cgtccgctcg acgaggtgga catcttcgtg gtcttcagcg cggcgaacag cgcgtggaag       480
     cgcttccggt gggattctcg cgacctgctc gtctgcgtcc gcaacgccat cggtggcgac       540
     cgggtgcaga cgatcggcac ccgcggccag gcgctgcgca tcgtctacga cgccgcgccg       600
     gacgtccacc tcgtgccggc cttcgaccac ccccgcgccg gctacgtcat cccggacaga       660
     gtgggcggct ggctgccgac ccggccggag cggcacgcga gctggacgat ggacctcggc       720
     ccgcgggtca tctcggcggt ccggctgctc aaggcgtgga accgggtgtg cggcagccac       780
     ctgcgctcgt tccacatcga ggcgctcgcg gggcaggtgc tcgcgggccg cggtctcaac       840
     acgcgccagg gcctcgccga ggtgttccgg cacatggacg aggtcggcct cgtggtcggc       900
     gatccgtccg acatccgcgg tgacctgtcc agctacctcc gccaggacga cctcgaggat       960
     cttggcgcct tcgtccgcca ggcacgcacc tactcggcca aggcggtcgc ggccgagcgc      1020
     gccggggacc acgaggaggc cgtcagcctg tggggcaccg tcttcggccc ggagttcccg      1080
     accttcgggt ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page