(data stored in ACNUC7421 zone)

EMBL: CP000820.PE222

CP000820.PE222       Location/Qualifiers
FT   CDS_pept        complement(273286..273810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0224"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: fal:FRAAL6647
FT                   conserved hypothetical protein (putative integral membrane
FT                   protein); putative cation-transporting P-type ATPase B"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09691"
FT                   /db_xref="GOA:A8LDS6"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS6"
FT                   /protein_id="ABW09691.1"
FT                   /translation="MHTAPADTPGPGWSSHSWRIDPGGWRGLSPQLRRLRRLLLLIGAI
FT                   PVIVLVSLIGGAFLGLPGLAVGAVPTAATVWGWRSIGRAWSAWRYAEREDDLLISHGTF
FT                   VRRLVVVPYGRMQLVDVTAGPLAQRFGIAQVRLHTAAATTDAVIPGLSPVEAARLRDSL
FT                   TERGEAQAAVL"
     atgcacacag ctccggccga tacccctggc ccggggtgga gctcccattc ctggcggatc        60
     gaccccggtg gctggcgggg cctgtcgccg cagctgcgcc gcttgcgccg gctgctgctg       120
     ctgatcggcg ccatcccggt gatcgtgctg gtaagcctga tcggcggggc gttcctgggg       180
     ctgcccgggc tggcggtggg ggccgtgccg accgcggcca ccgtgtgggg ctggcgctcg       240
     atcggccggg cctggagcgc ctggcgctac gccgagcgcg aggacgacct cctgatcagc       300
     cacggcacct tcgtccggag gctggtcgtc gtcccctacg gccgcatgca actggtggac       360
     gtcaccgccg ggccgctggc gcagcggttc ggcatcgcgc aggtgcggct gcacaccgcc       420
     gcggccacca cggacgccgt gatccccggg ctgtcaccgg tcgaggcggc ccggctgcgg       480
     gattcgctga ccgagcgcgg cgaggcccag gcggccgtcc tgtga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page