(data stored in ACNUC7421 zone)

EMBL: CP000820.PE223

CP000820.PE223       Location/Qualifiers
FT   CDS_pept        complement(273938..276175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0225"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: fal:FRAAL6646
FT                   conserved hypothetical protein; putative multidrug efflux
FT                   transporter AcrB transmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09692"
FT                   /db_xref="GOA:A8LDS7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS7"
FT                   /protein_id="ABW09692.1"
FT                   /translation="MGLPRPGATLRTRRFRWAVVLVWLLIGVAVSPLALMLTDAETNDA
FT                   AAFLPEGAESTRLLEAQRQLPGGDAVPAVVVLARDGGLTKADLDVATTLRTELAGFAAT
FT                   TTIPGVIPAPDHRAVIITVPMPQTTDADRFTADVARMRTIARQAAAAEPGLDSAVTGPA
FT                   GLVSDTYDVFVKIEGALLLVTASIVAVILLAVYRSPFLWVVPLLSVGIADQTAAGLIYL
FT                   LAEHAGLTVNGQSAGMLRVLVFGAGTDYALLLISRYREELTRHAEPATAMLVALRRAGP
FT                   AILASAGTVIIGMLCLLLGELNSHRGLGPVCAIGIAVALVTMLTLLPAAMVVGGRRLFW
FT                   PFVPRLGQAERSVEAGAWARAGAVIGRRPRTVWVTTVAVLGALVIGMLVLPGVLRQDQA
FT                   FRDNVESVQGQRLAERSFPPGVTAPTFVVANSARADAVAEAVRATPGVAAAAESGRTSE
FT                   LVQFLVVLDAPPDSPESFRTVEKLRTTVHALPGADALVGGNTAVNLDIRDAAVRDRELI
FT                   IPVVLVVVLLILGLLLRSVVAPLLLMGTVVLSFFAALGASALVYHYVFDFPGIDPALPL
FT                   IGFIFLVALGVDYNIFLMTRVKEETEHIGHAAGVRRGLAVTGGVITSAGVVLAATFAVL
FT                   LIFPLVQLAEVGFLVAFGVLLDTLVVRSVLVPALALDVGPVVWWPSHPERARPAGPVNG
FT                   QLTDQLTDHETLADFGALGVPLSAMEPAAAALESAEARARAEEDEDTEANR"
     atgggcctgc cgcgtcccgg tgccacgctc cgcacgcggc ggttccgctg ggcggtcgtc        60
     ctggtgtggc tgctgatcgg cgtcgccgtc agcccgctcg cgttgatgct caccgacgcc       120
     gagaccaacg acgcggccgc cttcctcccc gagggcgccg agtcgacccg tctgctggag       180
     gcccagcggc agctccccgg cggtgacgcc gtgccggcgg tggtcgtcct ggcccgtgac       240
     ggcggcctga ccaaggccga cctggacgtc gcgacgacgt tgcgcaccga actcgccggg       300
     ttcgcggcga cgacgacgat cccgggagtg atccccgcgc cggatcaccg cgcggtgatc       360
     atcaccgtcc cgatgccgca gaccacggac gccgaccgtt tcaccgccga cgtagcgcgc       420
     atgcggacaa tcgccaggca ggccgccgcc gcggaaccag gcctggattc cgcggtcacc       480
     gggcccgcgg gcctggtctc cgacacctac gacgtgttcg tgaagatcga gggcgcactg       540
     ctgctcgtga ccgcgtcgat cgtggccgtg atcctgctcg cggtctaccg aagtccgttc       600
     ctgtgggtcg tgccgctgct gtccgtcggc atcgccgacc agaccgcggc cggactgatc       660
     taccttctcg ccgagcacgc cgggctcacg gtgaacggcc agagcgccgg aatgctgcgg       720
     gtgctcgtct tcggcgccgg caccgactac gcgctgctgc tcatctcccg ctaccgcgag       780
     gagctgaccc ggcacgccga gccggccacc gcgatgctgg tcgcgctgcg ccgggccggc       840
     ccggcgatcc tggcgtcggc gggcacagtg atcatcggca tgctgtgcct gctgctgggc       900
     gagctgaact cgcaccgcgg gctgggcccg gtctgcgcga tcgggatcgc ggtcgcgctg       960
     gtcaccatgc tcacgctgct gccggcggcg atggtggtcg gcgggcgacg gctgttctgg      1020
     ccgttcgtgc cacgtctggg ccaggcggag cggtcggtgg aggccggcgc gtgggcgcgc      1080
     gccggcgccg tgatcgggcg ccgcccgcgg acggtctggg tcaccaccgt ggccgtgctg      1140
     ggcgcgctcg tcatcggcat gctcgtcctg cccggcgtcc tgcgccagga ccaggccttc      1200
     cgcgacaacg tcgagtcggt ccagggccag cgcctggccg agcggagctt cccgccgggc      1260
     gtcaccgcgc ccacgttcgt ggtggcgaac agcgcgcgcg ccgatgccgt ggccgaggcg      1320
     gtccgcgcga ctcccggcgt ggccgcggcg gcggagagcg ggcggacgtc cgagctcgtc      1380
     cagttcctgg tcgtgctcga cgcgccgccg gacagtcccg agtcgttccg gacggtggag      1440
     aagctgcgca cgaccgtgca cgcgctgccc ggcgccgacg ccctcgtcgg cggcaacacc      1500
     gccgtcaacc tggacatccg ggacgcggcc gtgcgggacc gcgagctgat cattccggtc      1560
     gtgctcgtcg tggtgctgct catcctcggg ctgctgctgc gttccgtcgt cgcgccgctg      1620
     ctgctcatgg gcacggtcgt gctgtcgttc ttcgccgccc tcggcgcgag cgcgctggtc      1680
     taccactacg tcttcgactt ccccggcatc gatccggcgc tgccgctgat cggtttcatc      1740
     ttcctggtgg cgctcggcgt cgactacaac atcttcctga tgacccgggt gaaggaggag      1800
     accgagcaca tcgggcacgc cgccggtgtc cgccgtggcc tcgcggtgac gggcggggtc      1860
     atcacctcgg ccggggtcgt gctcgccgcc acgttcgccg tgctgctcat cttcccgctg      1920
     gtccagctcg ccgaggtcgg cttcctggtc gcgttcggcg ttctgctcga cacgcttgtg      1980
     gtccgctcgg tgctcgtgcc ggcgctcgca ctggacgtcg gccccgtcgt gtggtggccc      2040
     agccacccgg aacgcgcccg gcccgccggc ccagtcaacg gccagctcac cgaccagctc      2100
     accgaccacg agacgctcgc tgacttcgga gcgctcggtg ttcccctgag cgcgatggag      2160
     cccgcggccg cggccctcga gagtgccgag gcacgagccc gggccgagga ggacgaagac      2220
     accgaagcga accgataa                                                    2238
//

If you have problems or comments...

PBIL Back to PBIL home page