(data stored in ACNUC7421 zone)

EMBL: CP000820.PE225

CP000820.PE225       Location/Qualifiers
FT   CDS_pept        complement(277387..278307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0227"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="PFAM: Indigoidine synthase A family protein; KEGG:
FT                   fal:FRAAL6645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09694"
FT                   /db_xref="GOA:A8LDS9"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS9"
FT                   /protein_id="ABW09694.1"
FT                   /translation="MISPGPGLAVSAEVSAALAAGRPVVALESTLIAHGLPRPRNRAVA
FT                   VELEEMLRERGVTPATVAVIDGVPTIGLDDATLSRVADDPAVAKASVRDLPAAAALRRT
FT                   CATTVASTSMLAARAGIRVFATGGLGGVHRGAGESFDESADLPTLGGTPITVVSAGVKS
FT                   ILDVGATLERMETLGITLLGWRTSEFPGFYLPGSGHRLDWRVDDARQVAGTMAARDRLG
FT                   LTSAIVVANPVPREQALDPGVHDRVLAEALRRAEAGGLRGKAVTPFLLETFRTETAGAS
FT                   LEVNVAVVRSNVAVAAEIATAWAAG"
     atgatttcac ccggtccggg cctggccgtc tccgccgagg tctcggcggc gctggctgcc        60
     ggccggccgg tggtcgccct ggagtcgacg ctgatcgccc acggcctgcc gcgcccgcgc       120
     aaccgcgcgg tcgccgtgga actggaggag atgctgcgcg agcgcggcgt cacccccgcg       180
     acagtcgcag tgatcgacgg agtgcccacc atcggcctgg acgacgccac gctcagccgc       240
     gtcgccgacg acccggcggt ggccaaggcg tccgtgcgcg acctgcccgc cgccgccgcg       300
     ctgaggcgca cctgcgcaac cacggtcgcg tccacgtcga tgctggccgc ccgtgcgggc       360
     atccgggtgt tcgcgacggg tgggctcggc ggcgtacacc gcggggcggg cgagtccttc       420
     gacgagtccg ccgacctgcc gacactgggc ggcaccccga tcaccgtcgt cagcgccggc       480
     gtcaagtcga tcctggacgt cggcgcgacc ctcgagcgga tggagaccct cgggatcacg       540
     ctgctgggct ggcgcacctc ggagttcccg ggtttctacc tcccgggctc cggccaccgt       600
     ctggactggc gggtggacga cgcccggcag gtcgctggca ccatggcggc ccgcgaccgc       660
     ctcgggctga cgtccgcgat cgtggtcgcg aacccggtgc cgcgtgagca ggcgctcgac       720
     cccggtgtcc atgaccgggt gctcgccgag gcgctgcgcc gcgccgaggc gggtgggctg       780
     cgcgggaagg ccgtcacgcc gttcctgctg gagaccttcc gcaccgagac cgccggcgcg       840
     agcctggaag tgaatgtcgc cgtagtacgg agcaatgtgg cggtcgcggc cgagatcgcg       900
     accgcctggg ccgccggctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page