(data stored in ACNUC7421 zone)

EMBL: CP000820.PE227

CP000820.PE227       Location/Qualifiers
FT   CDS_pept        complement(279463..282075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0229"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; Clp domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; ATPase AAA-2 domain protein; SMART: AAA ATPase;
FT                   KEGG: fal:FRAAL6643 ATP-dependent protease, HSP 100, part
FT                   of multi-chaperone system with DnaK, DnaJ, and GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09696"
FT                   /db_xref="GOA:A8LDT1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT1"
FT                   /protein_id="ABW09696.1"
FT                   /translation="MNADRLTARSQEALSSAISRATGDGSPLVDPLHLLTALLEAPDGV
FT                   GAALLEAVGTPAADIRSRAEAAVGRLPRAAGANVAPPQLSRQLVAVLNNAERQAARLGD
FT                   EYTSVEHLVVALAEEGGEASRILAEAGATPDALRGAFDRVRGGARRVTSRDPEGAYRAL
FT                   EKYSIDLTARARDGKLDPVIGRDTEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   LRVAAGDVPESLRGRRIVSLDLGSMVAGSKLRGEFEERLTSVLTEIREAEGQIITFIDE
FT                   LHTVVGAGAAEGAMDAGNMLKPMLARGELRMIGATTLDEYRTRIEKDPALERRFQPVMV
FT                   GEPSVEDTIGILRGLKERYEVHHGVRITDSALVAAATLSDRYVTARFLPDKAIDLMDEA
FT                   ASRLRMEIDSRPVAVDELERAVRRLEIEDMALSKENDDASRERRDRLQRELAEKREELS
FT                   ALTARWQREKNSISEVQKIKEELENARRAAEMAERDLDLAKAGELRYGTIPTLEKRLAE
FT                   ATGALAGSDSPGGAMLSEEVGPDDVAEVVASWTGIPAGRMLEGETSKLLRMETELHRRV
FT                   IGQDEAVRTVADAVRRARAGIADPDRPTGSFLFLGPTGVGKTELAKALADFLFDDERAV
FT                   VRIDMSEYAEKHSVARLIGAPPGYVGFESGGQLTEAIRRRPYSVILLDEVEKAHPDVFD
FT                   VLLAVLDDGRLTDGQGRTVDFRNTILILTSNLGSVYIADPTLPPQVRHDSVMVAVRDAF
FT                   KPEFLNRLDDVLVFEQLGRDDLTKIVDIQIDRLRRRLADRRISLEVTDAAKVWLADAGY
FT                   DPVYGARPLRRLVQTSIGDQLARELLAGQIRDGDGVVVDVDGQRSALSVHSAARAQAI"
     atgaacgctg accgtctcac cgcccgctcg caggaggctc tgtcctccgc gatcagccgt        60
     gccaccggcg acggatcgcc gctcgtcgac ccgctgcacc tgctgaccgc cctgctcgag       120
     gcgcccgacg gtgtcggtgc cgccctgctg gaggccgtcg gcaccccggc ggcggacatc       180
     cgctcccggg cggaggccgc ggtgggccgg ctcccccgcg ccgccggggc caacgtggcg       240
     ccgccgcaac tgtcccggca gctcgtcgcc gtcctgaaca acgccgagcg ccaggccgcc       300
     cggctcggcg atgagtacac ctcggtcgag cacctggtcg tggcgctcgc ggaggagggc       360
     ggggaggcgt cccgcatcct cgccgaggcg ggcgcgaccc cggacgccct gcgcggcgcg       420
     ttcgaccgcg tccgcggcgg cgcccgccgc gtcaccagcc gggatccgga gggggcctac       480
     cgggcgctcg agaagtactc catcgacctc accgcgcggg cccgcgacgg caagctcgac       540
     ccggtgatcg gccgcgacac cgagatccgc cgggtcgtgc aggttctctc ccggcgcacg       600
     aagaacaacc cggtcctgat cggcgagccc ggcgtcggca agacggcgat cgtcgagggg       660
     ctcgcgctgc gggtggccgc gggtgacgtc ccggagtcgc tgcgcgggcg gcgcatcgtc       720
     tcgctcgacc tcggctcgat ggtcgccggc tccaagctgc gcggcgagtt cgaggaacgg       780
     ctgacctcgg tgctcaccga gatccgcgag gccgagggcc agatcatcac cttcatcgac       840
     gagctgcaca ccgtcgtcgg cgccggcgcg gccgagggcg cgatggacgc cggcaacatg       900
     ctcaagccga tgctcgcccg cggtgagctg cgcatgatcg gcgcgacgac gctggacgag       960
     taccgcaccc gcatcgagaa ggacccggcg ctggagcgcc gcttccagcc cgtgatggtc      1020
     ggggagccgt ccgtggagga cacgatcggc atcctgcgcg ggctcaagga gcgttacgag      1080
     gtccaccacg gggtgcggat caccgactcg gcgctggtgg ccgcggccac cctgtccgac      1140
     cggtacgtca ccgcccggtt cctccccgac aaggcgatcg acctgatgga tgaggcggcg      1200
     tcccggctac ggatggagat cgacagccgg ccggtcgccg tcgacgagct cgagcgggcc      1260
     gtgcgccgtc tcgagatcga ggacatggcg ctgtcgaagg agaacgacga cgcgtcccgg      1320
     gaacggcgcg accggctgca gcgcgagctg gcggagaagc gcgaggagct ctccgcgctg      1380
     accgcgcggt ggcagcggga gaagaactcc atctccgagg tccagaagat caaggaggag      1440
     ctggagaacg cccgccgcgc cgccgagatg gccgagcgcg acctcgacct cgccaaggcc      1500
     ggtgagctgc ggtacggcac gatcccgacg ctggagaagc ggctcgccga ggcgaccggc      1560
     gcgctcgccg gatcggactc gcccggcggg gcgatgctca gcgaggaggt cggtcccgac      1620
     gacgtcgccg aggtcgtcgc ctcgtggacg ggcatccccg ccggccgcat gctcgagggc      1680
     gagacgagca agctcctgcg catggagacg gagctgcacc gtcgcgtgat cgggcaggac      1740
     gaggccgtgc gcaccgtggc ggacgccgtc cgccgcgcgc gggccggcat cgccgacccg      1800
     gaccggccga ccgggtcgtt cctcttcctc gggccgacgg gtgtgggcaa gacggagctg      1860
     gccaaggcgc tcgccgactt cctgttcgac gacgagcggg cggtcgtgcg catcgacatg      1920
     agcgagtacg ccgagaagca ctcggtggcg cggttgatcg gcgcgcctcc cggctacgtc      1980
     ggcttcgagt ccggcggcca gctcaccgag gcgatccggc gccgcccgta cagcgtgatc      2040
     ctgctcgacg aggtcgagaa ggcgcacccg gacgtcttcg acgtgctgct cgccgtactc      2100
     gacgacggcc ggctgaccga cggccagggc cgcacggtcg acttccggaa caccatcctg      2160
     atcctgacct cgaacctggg gtcggtctac atcgccgacc cgaccctgcc cccgcaggtc      2220
     cgccacgatt cggtgatggt cgccgtgcgc gacgccttca agccggagtt cctgaaccgg      2280
     ctcgacgacg tgctggtctt cgagcagctc ggccgggacg atctgacgaa gatcgtcgac      2340
     atccagatcg accggctgcg caggcggctg gccgaccgcc ggatctccct cgaggtgacc      2400
     gacgccgcca aggtctggct cgcggacgcc ggctacgacc cggtgtacgg ggcgcggccg      2460
     ctgcgccgcc tggtgcagac ctcgatcggc gaccagctcg cccgcgagct gctggccggc      2520
     cagatcaggg acggcgacgg ggtcgtggtc gacgtggacg ggcagcgctc ggcgctgagc      2580
     gtccactccg cggcccgcgc gcaggccatc tga                                   2613
//

If you have problems or comments...

PBIL Back to PBIL home page