(data stored in ACNUC7421 zone)

EMBL: CP000820.PE229

CP000820.PE229       Location/Qualifiers
FT   CDS_pept        complement(283089..284270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0231"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: DnaJ central domain protein; heat shock
FT                   protein DnaJ domain protein; chaperone DnaJ domain protein;
FT                   KEGG: fal:FRAAL6641 heat shock protein (HSP40),
FT                   co-chaperone with DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09698"
FT                   /db_xref="GOA:A8LDT3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT3"
FT                   /protein_id="ABW09698.1"
FT                   /translation="MSVRDMVEKDYYAALGVPKDASAADIKKAYRKLARELHPDKNPGD
FT                   VKAEARFKEVSEAYDVLSDENRRREYDEARALFASGSYPGAGGRGGGMGGFGTPGGYGP
FT                   GAGNLNLDDLLNGNGGGGLGGIFDNLFQRTPTGRAPRRGTDIAAEVTISFEKSLTGLEA
FT                   TVRLPGAATCATCAGIGARPGTSPRTCPVCRGLGVISRSQGGFALSEPCRDCLGKGSLI
FT                   DHPCPDCHGTGRREREQRIRIPAGVSDGQRLRVRGRGSPGERGGAAGDLEVTVHVQSHP
FT                   VFGREGHNLTINLPVTITEAALGASVKVPTIDGTPLTVKVPAGTSSGRRLRARNRGVPR
FT                   PGGENGDLIVTLEVTVPKPSELSPKARTALQEFARAHPEDPRESLIAQMEGRA"
     gtgagtgttc gcgacatggt tgaaaaggac tactacgccg ctctcggtgt ccccaaggac        60
     gcgtccgcgg ccgacatcaa gaaggcgtac cgcaagctcg cccgggagct gcacccggac       120
     aagaaccccg gggatgtgaa ggcggaggca cgcttcaagg aggtgtccga ggcctacgac       180
     gtcctctccg acgagaaccg ccggcgggag tacgacgagg cccgggcgct gttcgcctcc       240
     ggctcctacc cgggtgcggg tgggcgcggc ggcggcatgg gcgggttcgg gacgccgggc       300
     ggctacggcc caggtgccgg gaacctgaac ctcgacgacc tgctcaacgg caacggcggc       360
     ggcgggctcg gcgggatctt cgacaacctc ttccagcgga caccgaccgg gcgcgccccg       420
     cgccgcggca cggacatcgc ggcggaggtg accatctcgt tcgagaagtc gctgaccggc       480
     ctcgaggcga cggtgcggct gcccggggcc gccacctgcg ccacctgcgc cggcatcggg       540
     gcccgccccg ggacgtcccc ccggacgtgc ccggtctgcc ggggcctcgg cgtgatctcc       600
     cggtcgcagg gcgggttcgc gctgtccgag ccgtgccgcg actgcctggg caagggcagc       660
     ctgatcgacc acccctgccc cgactgccac ggcaccggcc gccgcgagcg cgagcagcgc       720
     atccgcatcc cggccggggt cagcgacggt cagcgcctgc gggtacgcgg gcgcggctcg       780
     cccggcgagc gcggcggcgc ggccggtgac ctcgaggtca ccgtgcacgt gcagagccat       840
     cccgtgttcg ggcgggaggg ccacaacctg acgatcaacc tgccggtgac gatcaccgag       900
     gcggccctgg gcgcctcggt gaaggtaccg acgatcgacg gcaccccgct gacggtcaag       960
     gttccggccg gcacctcgag cggacggcgg ctgcgtgccc gcaaccgggg cgtcccgcgc      1020
     cccggcgggg agaacggtga cctcatcgtg acgctcgagg tgaccgttcc caagccgtcc      1080
     gagctctcgc cgaaggcgcg caccgcgctc caggagttcg cgcgggcgca tcccgaggac      1140
     cctcgtgaat ccctgatagc ccagatggag ggacgggcat ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page