(data stored in ACNUC7421 zone)

EMBL: CP000820.PE23

CP000820.PE23        Location/Qualifiers
FT   CDS_pept        complement(28203..29546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0023"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: fal:FRAAL6832 polyamine ABC-transporter
FT                   ATP-binding protein; TIGRFAM: spermidine/putrescine ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09492"
FT                   /db_xref="GOA:A8LB31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB31"
FT                   /protein_id="ABW09492.1"
FT                   /translation="MPSSLSTPMSSRRSREQWRGQRGGDPGRRRPRCARVPAGRIRRTL
FT                   APAIEFVGVAKEYSSRAGLVGAVSRVDLSIEQGEFFSLLGPSGCGKTTTLRMIAGFEEP
FT                   TRGRILLHGRDVTAVPPNRRDVNLVFQSYALFPHLDVASNVAFGLRRRGVRGQELRRRV
FT                   GEILELVELSGLADRRPRALSGGQQQRVALARALVNRPRALLLDEPLGALDLKLRQTMQ
FT                   IELKRIQREVGITFVYVTHDQSEALTMSDRIAVMNRGRVEQLAAPREIYERPGTRFVAG
FT                   FIGTSNLLRRSVRSVDPAGVDGTPVAVLDSAAEERLVVPLRPELGRPATGSELEMTVRP
FT                   EKITLGVTRPNGTCCALHGRVTEVVYLGTYTTYTVLTHGGSEITVFWQNSADATNIADR
FT                   GDEVWLSWLPTHSFALAPSAHAKSTPPSALAPSGSLREDQNHTEGLAS"
     atgccgtcga gcctgtccac accgatgagc tcacggagaa gtcgtgaaca gtggcgaggc        60
     caacgcggtg gtgatcccgg ccgccgacga ccacgatgcg cccgcgtccc cgccggccgt       120
     atccgccgca ccctcgcacc cgccatcgag ttcgtcggtg tcgcgaagga atacagctcg       180
     cgcgccggtc tggtgggtgc ggtctcgcgg gtggatctca gcatcgagca gggcgagttc       240
     ttctcactgc tcggcccgtc cggctgcggc aagaccacca ccctgaggat gatcgccgga       300
     ttcgaggaac cgacccgcgg gcgcatcctg ctccacggcc gcgacgtcac cgccgtcccg       360
     cccaatcggc gcgatgtgaa cctcgtcttc cagagctacg cgctcttccc acacctggat       420
     gtcgcctcga acgtggcctt cgggctgcgg cgccgcgggg tccgcggcca ggagctgcgc       480
     aggcgggtcg gcgagatact cgagctcgtc gagctgtccg ggctcgccga ccggcggccc       540
     cgggcgctct ccggcggcca gcagcaacgg gtcgcgctcg ccagggcgct ggttaaccgg       600
     ccgcgggccc tgctgctgga cgaaccgctc ggagccctcg acctgaaact gcgccagacg       660
     atgcagatcg agctcaagcg aatacagcgc gaggtcggca tcacgttcgt gtacgtgaca       720
     cacgaccaga gcgaggcgct cacgatgtcg gaccggatag cggtgatgaa caggggccgc       780
     gtcgagcagc tcgccgcccc ccgggagatc tacgaaaggc ctggaacccg gttcgtggcc       840
     ggattcatcg gcacgtcgaa cctgctgcgc cgatcggtgc ggtccgtcga tccggccggc       900
     gtggacggaa ctccggtggc ggttctcgac tccgccgccg aagaacgcct ggtggttccg       960
     ctccggccgg agctcggccg gccagcgacc ggatccgagt tggagatgac cgtccggccg      1020
     gagaaaatca ccctgggtgt gacgcgcccc aacggaacgt gctgtgcgct gcacggtcgg      1080
     gtcaccgagg tcgtctatct gggcacgtac acgacataca cggtgttgac gcacggtgga      1140
     tccgagatca cggttttctg gcagaacagc gccgacgcga cgaacatcgc agaccggggc      1200
     gacgaggtgt ggctgtcgtg gctgccgacg cattccttcg ccctcgcacc gagcgcccac      1260
     gcaaagagca ccccgccgag cgcccttgca ccgagcggct ccctgcggga agaccagaac      1320
     cacacggagg gactcgcatc gtga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page