(data stored in ACNUC7421 zone)

EMBL: CP000820.PE236

CP000820.PE236       Location/Qualifiers
FT   CDS_pept        289991..292210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0238"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224 cysteine-rich
FT                   region domain protein; KEGG: fal:FRAAL6636 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09705"
FT                   /db_xref="GOA:A8LDU0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDU0"
FT                   /protein_id="ABW09705.1"
FT                   /translation="MRIAIGLAITLIALAVAGRRVFWLTRLIRSGQPAEGRLDDLPTRI
FT                   WTEISEVGGQRKLLKWSVPGLAHAFTFWGFTILGLTIVEAYGALFDHDFHIPLFGHWAA
FT                   IGFLEDFFAVAVLAGLITFTAIRLRNAPARLDRKSRFYGSHIGPAWVILGMITLVIVTL
FT                   LITRGAQFNAGTHPQGDTKWAFASWLVSLPLDAFSEHTNEHIETVFLLLNIAIIMGFLV
FT                   LVVYSKHLHIGLAPINVILKREPVALGPLGTTPDIEKLMEEDEPIVGVGKVEDFSWKAM
FT                   LDFSTCTECGRCQSQCPAWNTGKPLSPKLLIMDLRDHLFAKAPYLLAPKGAEDGESAEE
FT                   TTKAATSASEDGSGKHKVHHVPESGFGRVPEPGQPQVDRPLVGTAEEGGVIDPDVLWSC
FT                   TNCGACVEQCPVDIEHVDHIVDMRRYQVMIESAFPSEAGVMLRNLENNGNPWGVSPRSR
FT                   TEWTDGLPFEVRILDEGEQIPDEVEYLYWVGCAGAIEDRAKKVARSFAELLHTAGVEFA
FT                   ILGSQESCTGDPARRLGNEYLYQEMAKANIELLNETGVKKIVATCPHCFNSLAREYSSL
FT                   GGTFEVVHHTQLLGKLVEERKLVPITPIDSSVTYHDPCFLGRHNKVYTPPREILEAIPG
FT                   IRGQEMHRCKDRGFCCGAGGARMWMEEKIGKRVNVDRMEEALGLDPDVVSTACPFCIVM
FT                   LSDAVTEKKLAGEAKESVEVLDVSQLLARSLVAPTPTPAAEPLSS"
     gtgagaatcg cgatcggtct agcgatcacg ctgatcgctc tcgcggtggc cggccgccgc        60
     gtcttctggc tgaccaggct gatcaggtcc ggtcaaccgg cggagggccg gctcgacgac       120
     ctgccgaccc ggatctggac cgagatcagc gaggtcggcg gccagcgcaa gctgctcaag       180
     tggtcggtgc ccggcctggc gcacgccttc accttctggg gcttcaccat cctcggcctg       240
     acgatcgtcg aggcgtacgg ggccctgttc gaccacgact tccacatccc gctgttcggg       300
     cactgggcgg ccatcgggtt cctcgaggac ttcttcgcag tcgccgtgct cgcgggcctg       360
     atcaccttca cggccatcag gctgcgcaac gccccggccc ggcttgaccg caagtcccgg       420
     ttctacggct cccacatcgg cccggcctgg gtcatcctcg ggatgatcac tctggtcatc       480
     gtgaccctgc tgatcacccg tggcgcccag ttcaacgcgg gcacccaccc gcagggcgac       540
     accaagtggg cgttcgcgtc ctggctggtc agcctgccgc tggatgcctt ctcggagcac       600
     accaacgaac acatcgagac ggtgttcctg ctcctcaaca tcgcgatcat catgggcttc       660
     ctggtgctgg tggtctactc caagcacctg cacatcggcc tggcgccgat caacgtcatc       720
     ctcaagcggg agccggtcgc gctcggcccg ctgggcacca cgcccgacat cgagaagctg       780
     atggaggagg acgagccgat cgtcggggtc ggcaaggtcg aggacttctc ctggaaggcc       840
     atgctcgact tctccacctg caccgagtgc gggcggtgcc agagccagtg cccggcctgg       900
     aacaccggca agccgctgtc gcccaagctc ctgatcatgg acctccggga ccacctcttc       960
     gcgaaggctc cctacctgct cgcgcccaag ggcgccgagg acggcgagag cgccgaggag      1020
     accacgaagg cggccaccag cgcgtccgag gacggctccg gcaagcacaa ggtgcaccac      1080
     gtgcccgagt ccggcttcgg ccgtgtcccc gagcccggtc agccccaggt ggaccgcccg      1140
     ctcgtcggca ccgcggagga gggcggggtc atcgaccccg acgtcctgtg gtcgtgcacc      1200
     aactgcgggg cctgtgtcga gcagtgcccg gtggacatcg agcacgtcga ccacatcgtc      1260
     gacatgcgcc gctaccaggt catgatcgag tcggcgttcc cgtccgaggc cggcgtgatg      1320
     ctgcgcaacc tggagaacaa cggcaacccg tggggtgtct cgccgcgctc gcgcaccgag      1380
     tggaccgacg gcctgccgtt cgaggtgcgc atcctcgacg agggcgagca gatcccggac      1440
     gaggtcgagt acctctactg ggtcggctgc gccggcgcca tcgaggaccg ggccaagaag      1500
     gtcgcgcgct ccttcgccga gctgctgcac accgccgggg tcgagttcgc catcctcggc      1560
     agccaggagt cctgcaccgg tgacccggcg cgccgcctcg gcaacgagta cctctaccag      1620
     gagatggcga aggccaacat cgagctgttg aacgagacgg gcgtcaagaa gatcgtcgcg      1680
     acctgcccgc actgcttcaa cagcctcgcc cgggagtact cctcgctcgg cgggacgttc      1740
     gaggtcgtcc accacacgca gctgctcggc aagctcgtcg aggagcgcaa gctcgtcccg      1800
     atcaccccga tcgactcctc ggtgacctac cacgacccgt gcttcctcgg ccggcacaac      1860
     aaggtctaca ccccgccccg ggagatcctc gaggccatcc cgggcatccg tggccaggag      1920
     atgcaccgct gcaaggaccg tggcttctgc tgcggcgccg gcggcgcgcg gatgtggatg      1980
     gaggagaaga tcggaaagcg ggtcaacgtc gaccgcatgg aggaggccct cggcctcgat      2040
     cccgatgtgg tctcgacggc ctgcccgttc tgcatcgtga tgctctccga cgccgtcacc      2100
     gagaagaagc tcgccggcga ggccaaggag agcgtcgagg tgctcgacgt ctcgcagctg      2160
     ctggcccgtt cgctggtcgc gccgacgccc acgccggcag cggagccgct gagcagctga      2220
//

If you have problems or comments...

PBIL Back to PBIL home page