(data stored in ACNUC7421 zone)

EMBL: CP000820.PE24

CP000820.PE24        Location/Qualifiers
FT   CDS_pept        29898..30662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09493"
FT                   /db_xref="GOA:A8LB32"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB32"
FT                   /protein_id="ABW09493.1"
FT                   /translation="MRRLAAPSPLPGPEYTPSAVPLDILLGCARSHARLLEAVARVDDT
FT                   TARRPSLLPGWTVGHLVTHLARNADSHTGMFGAAAEGRVVAQYPGGLTQRDGGIEAGAH
FT                   QPADLLLADLAGAVARLERAWDGTHVDVWRGGLGLTAARGATSVADLVFLRWREAEIHL
FT                   VDLALTDRGGPEWDDLSPAYVEAEWAWSTRLLPERLPAEVTVLLTPGDRPSRAVGRGPQ
FT                   VVRVDVPTLPALRWLTGRDAGDPAWPPLGPWT"
     ttgcggcggt tggcggcgcc gagcccgctg ccgggaccgg agtacacacc gtccgccgtg        60
     ccgctcgaca tcctgctggg ctgcgcgcgg tcgcacgcca ggctgctcga agccgtcgcc       120
     cgcgtcgacg acacgaccgc ccgccgcccg tccctgctgc ccggctggac cgtcggccac       180
     ctcgtcaccc acctggcgag gaacgccgac agccacaccg ggatgttcgg ggcggccgcc       240
     gaaggacggg tcgtggcgca gtacccgggc ggcctgacgc agcgcgacgg cggcatcgag       300
     gcgggcgccc accagccggc cgacctgctg ctcgccgacc ttgccggcgc ggtggcccgg       360
     ctcgaacgag cctgggacgg cacccacgtc gacgtctggc gcgggggcct ggggctgacc       420
     gcggcgcgcg gcgcgacgag tgtggcggac ctggtgttcc tgcggtggcg tgaggccgag       480
     atccacctcg tcgacctcgc gctgaccgat cgcggcggcc cggagtggga cgacctcagc       540
     cccgcctacg tcgaggcgga gtgggcgtgg agcacgcggc tgctgcccga acggctgccc       600
     gccgaggtca ccgtcctgct gacccccggg gaccggccgt cgcgcgccgt ggggcggggc       660
     ccgcaagtcg tccgggtgga cgtcccgacg ctgccggcgt tgcgctggct gaccggccgg       720
     gacgccggcg atccggcctg gccgccgctg ggcccctgga cctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page