(data stored in ACNUC7421 zone)

EMBL: CP000820.PE249

CP000820.PE249       Location/Qualifiers
FT   CDS_pept        305715..306239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09718"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV3"
FT                   /protein_id="ABW09718.1"
FT                   /translation="MSPRVVMVGSGPSPLEPPPWWHPGHPGAALPKHRVRKAGQIRNTG
FT                   QVRDTSQIRKGRSSAQRRVQALAGPKAADRLDESSHRMAGWWGRLSSGIPASGRNTRHR
FT                   TPRIRGRWCHRRPLTDMKDIDDLRRHQRPRWTEWTARTGSSDRKGTDVPNRRGDIPIRT
FT                   TSRREEDRGIG"
     ttgtcccctc gcgtggttat ggtcggctca gggccctccc cgctcgaacc gccgccgtgg        60
     tggcatcccg gtcatcccgg ggcggctctg ccgaaacatc gagtacgcaa agccggtcag       120
     atacgcaata ccggtcaagt gcgcgatacc agtcaaatac gtaaaggccg gtcgagtgcg       180
     caacgccgag ttcaggcctt ggccggcccg aaagccgccg atcgcctgga tgaatcatcg       240
     caccgaatgg ccggatggtg gggtcgcttg agttccggga ttccggcttc cggccggaac       300
     acccgtcacc ggacaccgcg gatccgcggc cgttggtgtc accggcggcc gttgaccgac       360
     atgaaagaca tcgacgacct gcgacgacac cagcgaccgc ggtggacaga gtggacggcc       420
     cggaccggca gctcggacag aaaagggacg gacgtcccga atcgccgggg tgacataccc       480
     atcaggacca cgtcgagacg tgaggaggac cgcggcatcg ggtag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page