(data stored in ACNUC7421 zone)

EMBL: CP000820.PE250

CP000820.PE250       Location/Qualifiers
FT   CDS_pept        306334..307206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09719"
FT                   /db_xref="GOA:A8LDV4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019922"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV4"
FT                   /protein_id="ABW09719.1"
FT                   /translation="MPAGQWPRGTAERRDTAQELEELGYEMVWLGGATADLELPAALLE
FT                   STENLCVGTGILNIWTEPVDLLADTYGMLEKAHPSRLLLGVGTGHAKRVEATTGRRYHH
FT                   PYGAVLSYLDALDAVGIPVSVRVLAALGPRMLGLAAQRAAGAHPFLVTPEHTRMAREIL
FT                   GDGALLAPEQKIILEVDADRARAIGRAALAVYLDLPNYTNNLRRLGFTDADLAGGGSDR
FT                   LVDALVAWGNMDTIRARLDEHRAAGADHVCAQILTGSRELPREQWRDLAAGLDLRPRAG
FT                   AGAAHGTGP"
     atgcccgccg ggcagtggcc acgtggcacg gccgaacgtc gcgacaccgc ccaggagctc        60
     gaggagctcg gctacgagat ggtctggctg ggtggcgcga cggcggacct ggagctaccg       120
     gcggcgctgc tggagtccac cgagaacctg tgtgtaggca ccgggatcct gaacatctgg       180
     accgaaccgg tcgacctgct ggccgacacc tacggcatgt tggagaaggc ccatcccagc       240
     cgcctgctgc tcggggtggg aaccgggcac gcgaagcggg tcgaggcgac gacgggtcgc       300
     cgctaccacc acccctacgg cgccgtcctg tcctacctcg acgcgctcga cgcggtgggc       360
     atccccgtct cggtgcgggt gctggcggcg ctcgggccgc gcatgctcgg cctggccgcg       420
     cagcgggcag ccggggcgca ccccttcctc gtcacaccgg aacacacccg gatggcacgg       480
     gagatcctcg gcgacggcgc actgctcgcg cccgagcaga agatcatcct ggaggtggac       540
     gccgaccggg cccgcgcgat cgggcgggct gcgctggcgg tctacctgga cctgccgaac       600
     tacacgaaca acctgcggcg gctcggcttc accgacgccg acctggccgg cggcggcagc       660
     gaccgcctgg tcgacgccct cgtggcgtgg ggcaacatgg acaccatccg ggcacggctg       720
     gacgagcacc gcgcggccgg cgcggatcac gtctgcgcgc agatcctcac cggcagccgg       780
     gagctgccgc gggagcagtg gcgtgacctg gccgcggggc tcgacctgag gccgcgggcg       840
     ggcgccggag cggctcacgg aaccggcccc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page