(data stored in ACNUC7421 zone)

EMBL: CP000820.PE251

CP000820.PE251       Location/Qualifiers
FT   CDS_pept        307361..307921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgr:MGG_05575 predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09720"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV5"
FT                   /protein_id="ABW09720.1"
FT                   /translation="MPADRFSLDEAARTGAIRTPAAPTLVGPADASARPTPSAPAEVPA
FT                   TPAPAGKPDGSEDAPRPRAAADASCEVSAAGPAQTPSAPVAAVADGPASGPASFLSESG
FT                   GLLDSLMTGMDVGERSRMLGMISSSVEAEREAALDGRIRRQVDVGPRHRRRREPGQEPD
FT                   PASAGAGPDDVSDPAERSRRADR"
     atgcccgcag atcgtttttc cctcgacgaa gcggcccgca cgggagcaat ccgcacaccg        60
     gcggcgccaa cgctggttgg gccggccgat gcctcggcgc gtcccacgcc ttctgccccc       120
     gccgaagttc cggcgactcc cgccccggcc ggtaaacccg atggatccga ggacgcacct       180
     cgtccccgag ccgccgcgga cgcctcctgc gaggtgtccg cggcggggcc cgcgcagact       240
     ccgtccgcac ccgtggcggc cgtggcggac gggcccgcga gtgggcccgc gagctttctg       300
     agcgagagcg gcggcctgct ggacagcctg atgaccggca tggacgtcgg cgagcgctcc       360
     cgaatgctcg ggatgatcag ctcgagcgtg gaggccgagc gggaggccgc gctcgacggc       420
     cggatacgtc gccaggtcga cgtgggacct cgccaccggc ggcggcgtga gccaggtcag       480
     gagcccgatc cggcgtcggc cggcgcgggc ccggatgacg tctccgaccc cgccgagcgg       540
     tccaggcgcg cagaccggtg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page