(data stored in ACNUC7421 zone)

EMBL: CP000820.PE253

CP000820.PE253       Location/Qualifiers
FT   CDS_pept        308413..309117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0255"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; ANTAR domain protein;
FT                   KEGG: fal:FRAAL6620 putative transcriptional activator
FT                   protein TraR"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09722"
FT                   /db_xref="GOA:A8LDV7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV7"
FT                   /protein_id="ABW09722.1"
FT                   /translation="MEIDKARLDTSLTRLHHLVPERVELGELLSEAVRAITDVFGLDGA
FT                   GILVVDADRALRSVAASNSSGRLLEQVQEELGEGPCVESFVLDELVVSPDLAGEPRWPQ
FT                   ARPRLLAGGVRAVLGVPIRMGGGPIGTLNVADDSPREWTSAEREALERFGQVLESILLA
FT                   GMVADRSTKLARQLQFALDYRVPIDRAVGYLMAVWDTDAVTAFERLRRAARSSRRRVSE
FT                   LAEEILAGRVRL"
     atggagatcg acaaggcgcg cctggacacc agcctgaccc ggctgcacca cctcgtcccc        60
     gagcgggtag agctcggtga gctgctgtcc gaggccgtgc gcgcgatcac cgacgtcttc       120
     gggctcgacg gcgccggcat cctcgtcgtc gacgccgacc gggccctgcg cagcgtcgcc       180
     gcgagcaaca gcagtgggcg cctgctggaa caggtgcagg aggagctcgg cgagggcccg       240
     tgcgtcgagt ccttcgtcct ggacgagctg gtggtgagcc cggatctcgc gggtgagccc       300
     cgctggccgc aggccaggcc caggctgctc gccggcgggg tgcgggcggt cctcggcgtg       360
     ccgatccgga tgggcggcgg cccgatcggg acgttgaacg tcgccgacga ctcgccccgg       420
     gagtggacct ccgccgagcg cgaggccctc gagcggttcg ggcaggtgct ggagagcatc       480
     ctgctcgccg gtatggtcgc cgaccgcagc accaagctgg cccgccagct gcagttcgcc       540
     ctcgactacc gcgtccccat cgaccgggcc gtcggctacc tgatggccgt ctgggacacg       600
     gacgccgtca ccgccttcga acggctgcgc cgcgcggcgc gtagcagccg ccgacgggtg       660
     tccgagctgg ccgaggagat tctcgccggg cgggtccggc tctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page