(data stored in ACNUC7421 zone)

EMBL: CP000820.PE255

CP000820.PE255       Location/Qualifiers
FT   CDS_pept        310578..311339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09724"
FT                   /db_xref="GOA:A8LDV9"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV9"
FT                   /protein_id="ABW09724.1"
FT                   /translation="MTLLTVERIKLFSTRSPWWCMILAVALTVGLTAVFSAATKPSDLA
FT                   DLTPSVTQFAYNFGLVVMMVMAALAVTTEYRFGTIRSTFLAVPSRTPALLAKTVVVAGL
FT                   AGIVGEITAVASWGIARLIQPDAPLVLNTSQEYRNVFGIGLIYLLAAIFAIGLGLLIRH
FT                   TAGAIVVMLVYLFLAESLLPVIPRIGDHIQDWLPFIVGNNFIVAGQPETSDGPPVVEGL
FT                   PFGPWGSLIYFAAVCLGLLVIGLAAAKRRDA"
     atgacgctgc tcaccgtcga gcggatcaag ctcttctcca cccgctcgcc ctggtggtgc        60
     atgatcctcg cggtcgcgct caccgtcggc ctcaccgcgg tcttcagcgc cgcgaccaag       120
     ccgagtgacc tcgccgatct gacaccgagc gtgacgcagt tcgcatacaa cttcgggctc       180
     gtcgtgatga tggtgatggc ggcgctggcc gtcaccactg agtaccgctt cgggacgatc       240
     aggtcgacgt tcctcgccgt ccccagccgg acgccggcgc tgctggcgaa gacggtcgtc       300
     gtcgccggcc tcgccgggat cgtcggcgag atcaccgcgg tggcctcctg gggcatcgcg       360
     cgcctgatcc agccggacgc cccgctggtc ctgaacacca gccaggagta ccgcaacgtc       420
     ttcgggatcg ggctgatcta ccttctcgcg gcaatcttcg cgatcggtct cggcctgctg       480
     atccggcaca ccgcgggcgc gatcgtggtc atgctcgtct acctgttcct ggcggagagc       540
     ctgctgccgg tcatcccgcg catcggtgac cacatccagg actggctgcc cttcatcgtc       600
     gggaacaact tcatcgtcgc ggggcagccg gagacgagcg acgggccgcc ggtggtcgag       660
     ggcctgccct tcgggccctg gggatcgttg atctacttcg ccgcagtctg cctcggcctc       720
     ctggtgatcg gcctcgccgc cgccaagcgg cgggacgcct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page