(data stored in ACNUC7421 zone)

EMBL: CP000820.PE257

CP000820.PE257       Location/Qualifiers
FT   CDS_pept        complement(313980..314747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09726"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW1"
FT                   /protein_id="ABW09726.1"
FT                   /translation="MAIRRRTGVGFGRMFAVELTTPAVHPPRTISVFVVHRVLLRRRPR
FT                   ATPIVPVASGGPSKIGLIVSGPAGHARTVTSAHAPNTAGRHDRHTSWAAQKPTARAAPT
FT                   PPPSSATPATPAEPAADRTVPQVDDATSAAAGKLSEALEWVERARGALYSFHQLSGRAD
FT                   LILGEALDALREAGHPRLAAEVRRELHGRNVLDGRWTFQIVEEYDDLYYRPFVSTEERV
FT                   RALLTDGQRHVYEARMKARERSGAGRDPWGPGA"
     atggccatcc gccgccgcac gggcgtcggc ttcggtcgga tgttcgccgt tgagctcacc        60
     acaccggcag tgcacccacc acggaccatc agtgtcttcg tggtccaccg tgttctcctc       120
     cgtcgtcggc ctcgcgccac gcccatcgtg ccggtcgcct caggtggtcc gagcaagatc       180
     ggtttgattg tgtccggccc ggccgggcac gccaggactg tgaccagtgc ccatgcaccg       240
     aacaccgcgg ggcggcacga tcgccacacc tcgtgggcgg cccagaagcc cacagcgcgc       300
     gccgccccca cgccgccccc gtcctccgcg acgcccgcca cacccgcaga gcccgcggct       360
     gatcggacgg tcccgcaggt cgacgacgcg acctctgcgg cggccggcaa gctcagcgag       420
     gccctcgagt gggtggagcg cgctcggggc gcgctgtact ccttccacca gctctccggc       480
     cgcgccgatc tcattctcgg cgaggcgctg gacgccctgc gcgaggccgg gcacccgcgg       540
     ctggcggccg aggtacggcg ggagctgcac ggccgcaacg tgctggacgg acggtggacg       600
     ttccagatcg tcgaggagta cgacgacctg tactaccggc cgttcgtcag cacggaggaa       660
     cgagtgcgcg ccctgctcac cgacggccag cggcacgtct acgaggctcg gatgaaggct       720
     cgcgagcgtt ccggggccgg ccgcgacccc tggggccccg gcgcctga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page