(data stored in ACNUC7421 zone)

EMBL: CP000820.PE26

CP000820.PE26        Location/Qualifiers
FT   CDS_pept        complement(35609..36013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09495"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB34"
FT                   /protein_id="ABW09495.1"
FT                   /translation="MCQITVRSVSDQRRRQPAPQPAARAGSARGHDTASTPRPAPGEDF
FT                   HDGKHRDSAASLGLANVRPRQATTGRKPEGLPPLRPPVLTPMTAQQFTDAVHGLADLIS
FT                   LHLAPSLPRKIRHSPQQNRDRLESIDITEQ"
     ttgtgtcaga tcaccgtcag atcagtgtca gatcaacgcc gccgccagcc ggctccccag        60
     ccggcggcgc gggcgggctc cgcgagagga catgacacgg cgtccacacc ccgtccggcc       120
     ccgggcgaag actttcacga cggaaagcac cgcgactccg ccgcctcact cggactggcg       180
     aacgtacgac cgcgccaggc gactaccggc aggaagcccg aagggctacc gcccctgcgt       240
     cccccggtcc tgacaccgat gaccgctcag caattcacag acgcggtcca cgggctcgct       300
     gatctcatct cgctccacct ggcgccatcc ctgccgagaa agatccgaca tagcccacag       360
     cagaaccgcg accggcttga atcaattgac attaccgagc aataa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page