(data stored in ACNUC7421 zone)

EMBL: CP000820.PE262

CP000820.PE262       Location/Qualifiers
FT   CDS_pept        321432..322007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09731"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW6"
FT                   /protein_id="ABW09731.1"
FT                   /translation="MTTTENVVHDHRFTCGLCRLATEMVSEDEHRHHVEAFGRLGAADV
FT                   ELLDNLDAARALSDYVSRIFRIEACFDSWDNDQSLILFNSKSPGDVEPIGDVARRYLEM
FT                   ARTWYDAAAALADDLGAPYWVPGIPDNPLREITEAAIAEALSARNKVLVSWARLTLGTA
FT                   GPTPTIVGEHVETDSTAVLVRGSALRTA"
     atgacgacca ccgagaacgt ggtgcacgac caccggttca cctgcgggct gtgccggctg        60
     gcaaccgaga tggtcagcga ggacgagcac cgccaccacg tcgaggcgtt cggcaggctc       120
     ggcgccgcgg acgtcgagct gctcgacaac ctcgacgctg cccgcgcgct gagcgactac       180
     gtcagccgga tcttcaggat cgaggcctgc ttcgactcat gggacaacga ccagtccctg       240
     atcctcttca actccaagtc cccgggcgat gtggagccca tcggcgacgt cgccagacgg       300
     tacctggaga tggcgcgcac ctggtacgac gccgcggcgg ctctcgcgga cgacctggga       360
     gcgccctact gggtgccggg gatcccggac aacccgctgc gtgagatcac cgaggccgcg       420
     atcgctgagg ctctgtccgc ccgtaacaag gtgctcgtct cctgggcccg cctgacgctc       480
     ggcaccgccg ggccgactcc gacgatcgtc ggcgagcacg tggagaccga cagcacggcc       540
     gtactggtgc gtggcagcgc gctccgcacc gcctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page