(data stored in ACNUC7421 zone)

EMBL: CP000820.PE269

CP000820.PE269       Location/Qualifiers
FT   CDS_pept        325736..326326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09738"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX3"
FT                   /protein_id="ABW09738.1"
FT                   /translation="MTTIMDPVHTHRPISESADPVARAECSWHASAHLVAGLSVGLDPW
FT                   ELDLADPCASLPVLPDTYGGIRQDAVIAAAGRVGERMAPGRLDRPRVTIVCPGDVPAVP
FT                   VQHGLDDEVLEVARLWWRRIDAIGQALEVAGRLAAKDAVALFRADLEALPRYPLGDGEP
FT                   ARLSVRVWGCVEAGDLRGEMAARRHLAALGYGA"
     gtgacaacga tcatggaccc tgttcacacg caccgcccga tcagcgagag cgccgacccc        60
     gttgcccgcg ccgagtgttc ctggcacgcc agtgcccacc tggtggccgg gctgtccgtc       120
     gggctggacc cgtgggagct ggacctggcc gacccgtgcg cgagcctgcc cgtcctgccg       180
     gacacctacg gcggcatccg gcaggatgct gtcatcgccg ccgccggccg ggttggtgag       240
     cggatggccc ccggccggct ggaccggccc cgggtgacca tcgtctgccc gggtgacgtc       300
     ccggccgtgc cggtgcagca cgggttggac gacgaggttc tcgaggtcgc ccggctgtgg       360
     tggcgccgca tcgacgccat cggccaggcc ctcgaggtcg ccggccgcct ggccgccaag       420
     gacgcggtcg ccctgttccg cgcggacctc gaggcgctcc cgcgctaccc gctcggcgat       480
     ggtgagccgg cccggctgtc ggtgcgggtg tggggatgcg tcgaggccgg agatctccgc       540
     ggcgagatgg ccgcccggcg gcacctggcc gccctgggct acggcgcctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page