(data stored in ACNUC7421 zone)

EMBL: CP000820.PE27

CP000820.PE27        Location/Qualifiers
FT   CDS_pept        complement(36044..36967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_1435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09496"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB35"
FT                   /protein_id="ABW09496.1"
FT                   /translation="MIRCQISVRSPSDARVFTRTRKAAPPTSHMLCAMWADILLRRNRV
FT                   PQPPRHPPGPEPHPGHSTRLLVHGPVPSGRPCNAPAARSIATSNNTDALALGATGTGIV
FT                   TASPTGPTTDRSHSCARGVRPSHGRHTLRGRRRGTHRRSTTATASERNLTDPSTVSRPI
FT                   PAHPKAAHDLSPDIFQAGFRSSSPPCVASVASLCAGFPLTPAEGPPAAPSTSTGQPECM
FT                   DATAPAVPARPKVSPRSASDSPRFSPQPRSSGDRRSSPTDCTASPSIRPALPPPHVTVD
FT                   EDVRVLCGTSGRPSQSESPLAWANTI"
     atgatcaggt gtcagatcag tgtcagatca ccgtcagacg cccgggtatt cactcggacc        60
     cgaaaagccg ccccgcccac cagtcacatg ctctgtgcta tgtgggccga cattctgttg       120
     cggaggaacc gagtgcctca gccccctcgc cacccgcccg gacccgagcc acatccgggt       180
     cattccactc gtcttctggt ccacggaccg gtgccctccg gcaggccgtg caatgctccc       240
     gcggcccgtt ccatagccac ctccaacaac accgacgctc tggcgctcgg tgccaccggc       300
     acgggaatcg tgacggcgtc accgaccggc cccaccaccg acagatcaca ctcgtgcgca       360
     cgcggcgtac ggccatccca cggtcgccac acgctgcggg gaaggagacg aggcactcat       420
     cgtcgatcaa ccacggccac cgcctcggaa aggaatctca ccgatccgag taccgtctcg       480
     aggccgatcc cggcccaccc gaaagctgcc cacgacctgt cacccgatat tttccaggcc       540
     gggttccgct catcatcgcc cccgtgtgtg gcatcagtgg cgtctctgtg cgccgggttt       600
     ccgctaaccc ctgcggaagg gccacctgcg gcgccgtcga cgtcgaccgg gcagccggag       660
     tgcatggacg cgactgcacc cgcagtgccg gctaggccga aagtctcgcc gcgctccgcc       720
     tcggattcgc ctcgattctc accgcagccg cggtcctccg gcgaccggcg atcctcgcct       780
     actgactgca cggcgagccc gtcgatccgc ccggcgctgc ccccgccgca cgtcaccgtg       840
     gatgaggatg tccgcgttct ctgcggcacc agcggccggc ccagccagag cgagagtccc       900
     ctggcctggg caaacacgat ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page