(data stored in ACNUC7421 zone)

EMBL: CP000820.PE270

CP000820.PE270       Location/Qualifiers
FT   CDS_pept        complement(326817..327074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09739"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX4"
FT                   /protein_id="ABW09739.1"
FT                   /translation="MATACPDREPLRPAPRIPQAPRRPEVHVLPHSGGTTVQIDHGVTA
FT                   AEIGLALQLQVPALAPWLGTAVDEDGVAEMQFGRPGPIPR"
     atggctacag catgccctga ccgcgagccg ctgcgccccg ccccgcgcat cccccaggcg        60
     ccccgccggc ccgaggtgca cgtcctgccg cacagcggcg ggaccaccgt ccagatcgac       120
     cacggcgtca ccgcggcgga gatcgggctg gcgctccagc tccaggtgcc cgcgctcgcc       180
     ccgtggctcg ggaccgccgt cgacgaggat ggcgtcgcgg agatgcagtt cggccggccc       240
     ggcccgatcc cgcggtga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page