(data stored in ACNUC7421 zone)

EMBL: CP000820.PE272

CP000820.PE272       Location/Qualifiers
FT   CDS_pept        complement(327682..328056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09741"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX6"
FT                   /protein_id="ABW09741.1"
FT                   /translation="MSTWKPSPTQRRMDTAWMLTDISRALLGPTEYEELSDSTVELLSR
FT                   LTSVLMGVADACGDRDDRATWAAAGQPEQAPDRDPDINVTDAELIVDVAERMFTGAFRR
FT                   RNDERRAARDRAAEAEQDAA"
     gtgagcacgt ggaagccgag cccgacgcag cgccggatgg acacggcctg gatgctcacg        60
     gacatcagcc gggcgctgct cgggccgacg gagtacgagg aactgagcga cagcacggtg       120
     gaactgctgt cgcggctgac gtcggtgttg atgggtgtgg ccgacgcctg cggtgaccgg       180
     gacgaccggg cgacgtgggc ggcagccgga cagccggagc aggcgccgga ccgagacccg       240
     gacatcaacg tgaccgacgc cgagttgatc gtcgatgtgg cggagcggat gttcacgggc       300
     gcgttccgcc gacggaacga tgagcggcgc gccgcgcggg accgggcggc tgaggctgag       360
     caggacgctg cctga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page