(data stored in ACNUC7421 zone)

EMBL: CP000820.PE273

CP000820.PE273       Location/Qualifiers
FT   CDS_pept        complement(328053..328334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09742"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX7"
FT                   /protein_id="ABW09742.1"
FT                   /translation="MAHRPHWRCPVSVSDFGIGERFEMAQMLSNLAAMAVTVDDSRAEP
FT                   DMLTDAAAIELLPLVRQLDRAIRAHARSDYEHGVAYALLADLNLGGSL"
     gtggcacacc gcccgcactg gcggtgccct gtgagcgtca gcgacttcgg tatcggcgag        60
     cggttcgaga tggcgcagat gctgtcgaac ctggctgcga tggcggtcac cgtcgacgac       120
     tcccgcgccg agccggacat gctcaccgac gccgcggcta tcgagctgct gcccctggtg       180
     cgccagctcg accgggccat ccgggcccac gcccgttccg actacgagca cggcgtcgcc       240
     tacgcgctgc tggccgatct gaaccttggg ggttccctgt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page