(data stored in ACNUC7421 zone)

EMBL: CP000820.PE275

CP000820.PE275       Location/Qualifiers
FT   CDS_pept        complement(328531..329010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09744"
FT                   /db_xref="GOA:A8LDX9"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX9"
FT                   /protein_id="ABW09744.1"
FT                   /translation="MGTAQVVLAEAPTPRPGPDPILSKQERTVSHIFSVVAFIATMLLT
FT                   LTRRISPTERARVVIRHAHLAGSGLPVTRADVIADLATLDGRGFPDGKPAVTPDPEPPL
FT                   PDPAPDDIVTLDVAAARLSVSVATIRRYCAPSSGRLIRAGSGVTRASLEAVAATR"
     ttgggcactg cccaagtggt cctggccgag gctcctaccc cccggccagg acccgatccg        60
     atcctgagca agcaggagcg aaccgtgtcc cacatcttct cagtcgtggc gttcatcgcc       120
     acgatgctgc tcaccctcac ccggcggatc tcgccgaccg agcgcgccag ggtcgtcatc       180
     cggcacgcgc acctggccgg atccggcctg cccgtcaccc gggcggacgt catcgccgac       240
     ctggccaccc tcgacggacg aggctttcca gatggaaagc ctgccgtcac cccggatccg       300
     gaaccgccac tcccggatcc ggcccctgac gacatcgtca ccctcgacgt cgcggccgcc       360
     cggctcagcg tctccgtagc caccatccgc cggtactgcg caccctcgtc gggcaggctg       420
     atccgagccg gatccggtgt cacccgcgcg tctctcgagg ccgtggcggc gacccgatga       480
//

If you have problems or comments...

PBIL Back to PBIL home page