(data stored in ACNUC7421 zone)

EMBL: CP000820.PE276

CP000820.PE276       Location/Qualifiers
FT   CDS_pept        329052..329246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09745"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY0"
FT                   /protein_id="ABW09745.1"
FT                   /translation="MGIPKLWTSKDVAGRLKVSSERVRQLSHRDDFPDPVGEVGHIRVW
FT                   AESDVEEWIKKNRPDKADG"
     atggggattc cgaagctctg gacgtccaag gacgtcgccg gccggctcaa ggtcagctca        60
     gagcgcgtgc gccagctctc ccaccgcgac gactttcccg acccggtggg ggaggtaggc       120
     cacatccggg tgtgggccga gagcgacgtc gaggaatgga tcaagaagaa ccgccccgac       180
     aaggcggacg ggtga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page