(data stored in ACNUC7421 zone)

EMBL: CP000820.PE278

CP000820.PE278       Location/Qualifiers
FT   CDS_pept        330616..331425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6608 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09747"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY2"
FT                   /protein_id="ABW09747.1"
FT                   /translation="MTVCGLLRLDGADVRHSALTGMLAASSIGLPAARRVHLDGPFGVV
FT                   TAADSATGPMPSVLVGPSGLVIVIAEHAADGWVVPGVGSVTVLRPGRSWRPVPLRSLRG
FT                   GKPDGDAVHLGKRRDPGDLGDASGTVDDELGDLGSRGERDRAADGDHGTGVASALMRAY
FT                   RAAGQRALETLGEHLLAIVWEPGRRRMIVSRGGRRADELVVWSDGRYFAFGMERAQVLA
FT                   ARPFGLARPRRLAAGETLPVTVATRIRRPPFVDLPEPRGSEADVPAT"
     atgaccgtgt gcgggctgct gcggctggac ggcgcggatg tccgtcactc ggcgctgacc        60
     gggatgctcg cggcttcctc gatcggtctg cccgccgcgc gtcgcgtgca cctggatggt       120
     ccgttcgggg tggtgacggc cgctgacagc gccaccggcc cgatgccgtc cgtgcttgtg       180
     gggccgtccg ggctggtcat cgtgatcgcg gagcatgccg cggacgggtg ggtcgtcccc       240
     ggcgtggggt cggtgaccgt gctacggccg gggagatcat ggcggccggt gccgctgcgc       300
     tcgctgcgcg gggggaaacc ggacggagac gccgtccacc tcggaaaacg gagggaccca       360
     ggtgatctgg gtgatgccag cgggactgtt gacgatgagc tcggtgatct gggatcgcgc       420
     ggggagcggg accgggcggc tgacggagat cacggcacgg gagtcgcgtc cgcgctgatg       480
     cgtgcgtacc gggcggctgg ccagcgcgcg ctggagacgc tgggggagca cctgctggcg       540
     atcgtctggg agccgggccg ccggcggatg atcgtgagcc gtggtggccg gcgtgcggac       600
     gagcttgtgg tctggtccga cgggcggtac ttcgcgttcg ggatggagcg ggctcaggtc       660
     ctcgcggcgc ggccgttcgg gctcgcccgg ccgcgccgac tcgcggccgg ggagaccctt       720
     cccgtcaccg tcgcgaccag gatccggcgc ccgccgttcg tggacctccc cgagccgcgg       780
     gggagcgagg ccgacgtccc ggcgacctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page