(data stored in ACNUC7421 zone)

EMBL: CP000820.PE280

CP000820.PE280       Location/Qualifiers
FT   CDS_pept        complement(331893..332435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6606 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09749"
FT                   /db_xref="GOA:A8LDY4"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY4"
FT                   /protein_id="ABW09749.1"
FT                   /translation="MRRILLSPWWLARHALALLLIAFFLRMGVWQWTKGESDHGSMQNL
FT                   FYGVEWPMFAAFVVYWWYRMISEDLRPRDPDDPGPQWGKGGRIAPEAPAPTGGDPLNGP
FT                   GSLVAVPRQGKAGTVAVTSAPARLGRPTAGDPLAGDPLAEVETDEDRELAAYNRYLASL
FT                   YERDAAGSDNDTKGDRR"
     gtgcgcagga tcctgctctc cccgtggtgg ctcgcccgtc acgcgctcgc gctcctcctg        60
     atcgcgttct tcctccggat gggcgtctgg cagtggacga agggcgaatc cgatcacggc       120
     agcatgcaga acctcttcta cggcgtcgaa tggccgatgt tcgccgcgtt cgtcgtctac       180
     tggtggtatc gcatgatctc cgaggatctc cgcccacgcg accccgacga tccgggaccc       240
     cagtggggca agggcgggcg catcgcgccc gaggcgcccg ctcccacggg cggcgacccc       300
     ctgaacggac caggctcact cgtggccgta ccgcgccagg ggaaagccgg aaccgtggcg       360
     gtgacgtccg cgccggcccg gctcggccgt ccgacggctg gtgatccgct ggctggtgat       420
     ccgctggccg aggtggagac cgacgaggac cgcgagctcg ccgcctacaa ccgctatctc       480
     gcgtcgctgt acgaacgcga cgccgctggc tccgacaacg acaccaaggg agaccgccgg       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page