(data stored in ACNUC7421 zone)

EMBL: CP000820.PE281

CP000820.PE281       Location/Qualifiers
FT   CDS_pept        complement(333017..334603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09750"
FT                   /db_xref="GOA:A8LDY5"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY5"
FT                   /protein_id="ABW09750.1"
FT                   /translation="MIRDRFISSSSRRRVDGHGTAGGQAGTGDRAETGSVAASAPVSDG
FT                   SGAATATPPSSQDFTSTLRSLLARELTEHDPDTERIRARIAAMDPSAARHLAPAARPVD
FT                   HPVIPAPRTTPLAGTTSPAGAPPPTGPTPSTGPVEPGPAGTPPPAGAAARPRATARQRR
FT                   PRRTRPRLLIPTVVGTAATALVGVVLLSGTLFTPRPDTGTVTAAPTRIPRTASADAGNA
FT                   SPADSLGVTPAPSSAGPPSPAPGDGDPAVLSPEGLPSQGAGTSAAPSGAPDGPASQSDQ
FT                   GTGGSAPQDTRPGSGGSGGNDAAPRRDDSRHSGDWDGSGSADRGSGEADTPPGRDGARR
FT                   DSGDSGDSGGSGGSGGVSVSTAPFSRGQEVSLPTAGCLDWVLFGADGVQTRADIPRPGI
FT                   GTARIERGPGSGSGGFANRFSWHGGRPVSSGSRDDDRLVVEGSVRLDVALAGQARRLDL
FT                   YLGSPDGSVRVTVGDGRNAWSRSVALSARQRGDADGVLSVWLPRGQGSIAVTVAAGSGV
FT                   GLLTLAAGVLY"
     atgatcaggg accgtttcat ctcgagctct tcccgccgcc gggtggacgg tcacggcacc        60
     gcgggcggtc aggctggcac cggcgatcga gctgagaccg gctcggtggc ggcctcggcg       120
     cccgtcagcg acggctccgg agcggccacg gccacgccgc cgtcctccca agatttcacc       180
     agcacgctgc ggtccctact ggcccgcgag ctcacggagc acgatccgga cacagaacgc       240
     atccgtgccc gcatcgccgc gatggacccg tcggcagccc ggcacctggc gcccgcggcc       300
     cggccggtcg atcacccggt gatcccggcg ccgagaacaa cgccgctggc agggacgaca       360
     tccccggcag gagcaccgcc gccaacagga ccaacgccgt cgacaggacc agtagaacca       420
     ggaccggcag gaaccccacc gccagcggga gcagccgcac gcccgcgcgc gaccgcgcgc       480
     cagcgccgcc ctcgccggac gcggccacgc ctgctcatcc ccacggtcgt gggcacggcc       540
     gcgaccgccc tggtcggcgt cgtcctgctg agcggcaccc tgttcacccc ccggccggac       600
     acgggcaccg tgacggccgc gccgacccgg attccccgca cagcctccgc cgatgccgga       660
     aatgcgtcac cggccgacag cctcggcgtc acccccgctc cgagtagcgc cgggccaccg       720
     agtccggcgc cgggcgacgg ggacccggcc gtgctgagcc ccgaaggtct tccgtcccag       780
     ggcgcgggca cgagcgcggc accgtccggc gcgccggacg gaccggcgtc ccaatctgac       840
     caggggacgg gcggatcggc gccgcaggac acccggccgg gcagtggcgg cagcggcggc       900
     aacgacgccg ctccccgccg cgacgactcg cgccactccg gcgactggga cggctccggc       960
     tccgcggacc gcggctccgg cgaagccgac acgcccccgg gtcgcgacgg cgcacggcgt      1020
     gactccggcg actccggcga ctccggcggt tcaggtggct cgggcggtgt cagcgtgtcc      1080
     acggcgccgt tcagccgcgg ccaggaagtg agcctgccga cggcggggtg cctcgactgg      1140
     gtcctgttcg gcgcggacgg cgtccagacc cgggccgaca tcccgcggcc cgggatcggc      1200
     accgcccgga tcgagcgcgg ccccggctcc ggctcgggcg gattcgccaa ccgcttctcc      1260
     tggcacggcg gccggcccgt cagctccggt tcccgcgacg acgaccgact ggtcgtcgag      1320
     ggctccgtac ggctggacgt ggccctggcc ggccaggcgc ggcgcctcga tctctatctg      1380
     ggctccccgg acggcagcgt gcgcgtcacc gtgggcgatg gtcggaacgc ctggtcgcgc      1440
     agcgtggcac taagtgcccg gcagcggggg gacgccgacg gggtgctctc cgtgtggctt      1500
     ccccgcggtc agggctcgat cgccgtcacc gtggcggccg gttcgggcgt cgggctactc      1560
     acgctcgcgg cgggagtcct ctactga                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page