(data stored in ACNUC7421 zone)

EMBL: CP000820.PE284

CP000820.PE284       Location/Qualifiers
FT   CDS_pept        337539..338171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09753"
FT                   /db_xref="GOA:A8LDY8"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY8"
FT                   /protein_id="ABW09753.1"
FT                   /translation="MTGRDVRRATGMDSSDQEGRMVGMTDQPEPRVVVVGPDGALQEAP
FT                   GAVGVPLTPSAGHGGRAGDDGPGEGKNPFAGMVSQPDKVMRIGTMIKQLLEEVRAAPLD
FT                   DASRVRLRQIHQSSITELSDGLAPELRAELDRLSLPFDEDATPSDGELRIAQAQLVGWL
FT                   EGLFHGLQTALFAQQMAARAQLEEMRRRALPSGQQQGDNEPFGGAYL"
     gtgaccggac gagatgttcg acgtgccacc gggatggatt cgtccgacca ggagggcagg        60
     atggtgggca tgacagacca accggaaccc cgtgtcgtcg tcgtcggccc ggacggcgcc       120
     ctgcaggagg cccccggcgc ggtaggcgtc ccgctcacgc cttccgcggg gcacggcggg       180
     cgggccggcg acgatgggcc gggcgagggc aagaacccct tcgccggcat ggtgtcccag       240
     ccggacaagg tcatgcggat cggcaccatg atcaagcagc tgctcgagga ggtgcgggcc       300
     gcaccgctcg acgacgccag ccgcgtccgg ctccggcaga tccaccagag ctcgatcacc       360
     gagctctcgg acgggctcgc cccggagcta cgcgcggagc tcgaccgcct gtcgctgccg       420
     ttcgacgagg acgcgacccc ctccgacggg gagctgcgga tcgcccaggc gcagctcgtc       480
     ggctggctcg aggggctctt ccacgggttg cagaccgcgc tgttcgccca gcagatggcg       540
     gcgcgggcgc agctcgagga gatgcgtcgc cgggctctgc ccagcgggca gcagcagggc       600
     gacaacgagc cgttcggcgg cgcctacctc tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page