(data stored in ACNUC7421 zone)

EMBL: CP000820.PE287

CP000820.PE287       Location/Qualifiers
FT   CDS_pept        complement(341569..342840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09756"
FT                   /db_xref="GOA:A8LDZ1"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ1"
FT                   /protein_id="ABW09756.1"
FT                   /translation="MTQGCGRCEMTALTSIEPGTEIPVGDLVVIGVALTVVAACLGRLR
FT                   AAFILGIPTLLLAGIATILGWLLGGTADSGNTVPPPARSLSPEATAGAAPGGGTHWGAF
FT                   FLTVLGAVLIILGTVVWAIWSKRHSERFELGNGAGSVPQPDPTALRWTHSDLPVSLSEL
FT                   DDDFYPDLPVQHQTPPDLNAWAPETAPADGRESTMGGPGQPRSRRNHQDQPTDPFFENI
FT                   AARIDRIVGLYLNAVTPRPGRPARVDLLAPDAQYFVSALTTTLDLFGGTAPADRMEPLV
FT                   EAVREVERRWDAVIGTRIGPNTPDETETARAPSAAPPRPAPGRPARDTKSTDEHADVPR
FT                   PTAASKHRLRIPPRPTPPPRPALPLVPGGTNSDGDRRRRRLPGEHPARNHRIRPELDRP
FT                   AEPDEPDGPSSPRESDRPDRPDRT"
     ctgacacagg gctgcgggcg gtgtgagatg accgcgctca catccattga gccaggaact        60
     gagatcccag tcggggacct cgtcgtcatc ggtgtggcgc tcaccgtcgt cgccgcctgc       120
     ctcggcaggc tccgcgccgc attcatcctc ggcattccga cactgctgct agcgggcatc       180
     gcgacgatac tcggctggtt gctcggcggc acggccgaca gcggcaacac agtcccgccg       240
     ccggcgcgga gcctgtcccc cgaggccacc gccggcgccg cacccggcgg cggcacgcac       300
     tggggcgctt tcttcctgac cgtgctcggc gcggtgctca tcatcctcgg tacggttgtg       360
     tgggcaatct ggtccaagcg acacagtgag cggttcgaac tcgggaacgg ggccgggtca       420
     gttccacagc cggatcccac cgcgctgcgg tggacacact ccgacctccc cgtgtccctg       480
     tcggagctgg acgacgactt ttaccccgac ctacccgtcc agcaccagac gccgccggac       540
     ctgaacgcat gggcgccgga aaccgcacct gccgatggca gggagagcac gatgggcggg       600
     cccggccaac cgcggagccg gcggaatcac caggaccagc cgaccgaccc gttcttcgag       660
     aacatcgcgg cccgcatcga ccggatcgtc ggcctgtatc tgaacgcggt gacgccccgg       720
     cccggtcgtc cggcccgcgt cgatctgctc gcgccggatg cccagtactt cgtcagtgca       780
     ctgaccacaa cactggacct gttcggtggc acagccccgg ccgatcggat ggaaccgctc       840
     gtcgaagccg tccgcgaggt ggaacgtcgg tgggacgccg tcatcggaac ccggatcggg       900
     ccgaacacgc cggacgagac cgagacggcc agggcgccgt cggcggcccc accccgaccg       960
     gccccgggac gcccggcccg cgataccaaa agcaccgacg agcacgccga cgtgccacgc      1020
     cccacggcag cgtcgaagca ccggctgcgg ataccgccac ggcccacgcc tcccccacgg      1080
     cccgcactcc cgctggtgcc cggcggcacg aacagcgacg gcgaccggcg ccgccgcagg      1140
     ctgccgggcg agcatcccgc gaggaaccac cggatccgcc cggagctcga ccgaccggcg      1200
     gaacccgacg agcccgacgg gcccagcagc cctcgcgagt ccgaccggcc cgaccggccc      1260
     gaccgcacct ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page