(data stored in ACNUC7421 zone)

EMBL: CP000820.PE290

CP000820.PE290       Location/Qualifiers
FT   CDS_pept        complement(345121..345927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0293"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase type 3; KEGG: fal:FRAAL6592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09759"
FT                   /db_xref="GOA:A8LDZ4"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ4"
FT                   /protein_id="ABW09759.1"
FT                   /translation="MVDWLLVSRPVLVATDLDGTLIRTDGTVSDRTRDALRQVENSGST
FT                   VVFVTGRPTRVMADVVRQTAVSGLAICANGALVYDLDTGVPVSQTILETPAALKLAAAI
FT                   RAAVPDATFAVESGVRFGREPDFLTMWPDPGELVAGFHELLEHLPATKLLVRRGGASLA
FT                   DVYETVVALAGTEAVVTTSSHDLIEIAGPGVSKAVALAELASERGVLAAEVVAFGDMPN
FT                   DLPMFAWAGHSVAVANAHPDVLAAADEITASNDDDGVAQVLERLFS"
     atggttgact ggttacttgt gtcccgtccc gttctcgtcg ccaccgacct ggacggaacc        60
     ctgatccgca ccgacggcac cgtctccgac cggaccaggg acgccctgcg acaggtcgag       120
     aactccggct ccacggtcgt gttcgtcacc ggccgtccca cccgggtgat ggcggacgtc       180
     gtccggcaga ccgcggtctc gggcctcgcc atctgcgcga acggcgcact cgtctacgac       240
     ctcgacaccg gcgttccggt aagccagacg attctggaga cgcccgcggc gttgaagctg       300
     gccgccgcga tccgggcagc ggtacccgac gccaccttcg cggtggagag cggcgtgcga       360
     ttcggccgcg aacccgattt cctgaccatg tggccggatc cgggcgaact ggtcgccggt       420
     ttccacgagc tgctcgagca cctgcctgcg acgaagctgc tggtccgccg gggcggcgcg       480
     tcgctggccg acgtgtacga gacggtcgtc gccctggccg gaaccgaggc ggtcgtgacg       540
     acgtccagtc acgacctgat cgagatcgcc ggcccggggg tgtcgaaggc cgtcgcgctg       600
     gctgaactgg cgagcgagcg cggtgtgctc gccgccgagg tggtcgcgtt cggcgacatg       660
     cccaacgacc tgcccatgtt cgcctgggcc gggcattcgg tagcggtcgc caacgcccat       720
     ccggacgtcc tcgccgccgc cgacgagatc accgcgtcga acgacgacga cggtgtcgct       780
     caggtactgg aacggctgtt ttcctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page