(data stored in ACNUC7421 zone)

EMBL: CP000820.PE292

CP000820.PE292       Location/Qualifiers
FT   CDS_pept        346689..347537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0295"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: fal:FRAAL6590 ATP phosphoribosyltransferase
FT                   (ATP-PRTase) (ATP-PRT); TIGRFAM: ATP
FT                   phosphoribosyltransferase; PFAM: Histidine biosynthesis
FT                   protein HisG domain; ATP phosphoribosyltransferase
FT                   catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09761"
FT                   /db_xref="GOA:A8LDZ6"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ6"
FT                   /protein_id="ABW09761.1"
FT                   /translation="MMLRIAVPNKGGLAAASSQLLCDAGYLARRESAELVVADVENDIE
FT                   FFFLRPRDIAVYVGTGRLDLGITGRDLLVDSNTSAQELVPLGFGQSAFHYAAPAGTMSD
FT                   IKELDGLRVATSFPGLVRTDLAGRGISVQIVKLDGAVETAVRLGVADAVADVVETGRTL
FT                   RAAGLELVGESVLRSEAIMIAKRGADLSAAHERLLRRVQGVLVARRYVMMDYDVPSSVL
FT                   EKACEVTPGYESPTISPLQREGWVAVRAMVLKADVNRTMDDLWDLGARGILVSGIQACR
FT                   L"
     atgatgctgc gtattgcggt tccgaacaag ggtgggctcg cggcggcctc cagccagttg        60
     ctgtgcgacg cgggttacct cgcgcggcgg gagtccgccg agctggtggt ggccgacgtc       120
     gagaacgaca tcgagttctt ctttctgcgt ccgcgtgaca tcgccgtgta cgtcggcacc       180
     ggccggctcg atctcggcat caccggccgt gatctcctcg tcgacagcaa cacgtcggcg       240
     caggagctgg tgcccctcgg gttcggccag tcggcgttcc actacgcggc gccggccggc       300
     accatgagcg acatcaagga gcttgacggg ctgcgggtcg ccacgtcgtt ccccggcctg       360
     gtgcgtaccg acctcgccgg gcgcggcatc tcggtccaga tcgtcaagct ggacggcgcc       420
     gtcgagaccg ccgtgcggct cggcgtggcg gacgcggtgg ccgacgtcgt cgagaccggg       480
     cggaccctgc gggcggccgg gctcgagctc gtcggcgagt cggtgctgcg ctccgaggca       540
     atcatgatcg ccaagcgcgg ggcggatctg tcggccgctc acgagcggct gctgcgccgg       600
     gtgcagggcg tcctggtggc ccggcggtac gtgatgatgg actacgacgt gccctcctcc       660
     gtgctggaga aggcctgcga ggtcaccccg ggctacgaat ccccgacgat ctccccgctg       720
     cagcgggagg gctgggtcgc ggtccgggcg atggtcctga aggccgacgt caaccgcacc       780
     atggacgacc tgtgggatct cggcgcgcgc gggatcctgg tctccggtat ccaggcctgc       840
     cggctgtag                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page